BLASTX nr result
ID: Gardenia21_contig00004225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00004225 (208 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007133039.1| hypothetical protein PHAVU_011G146200g [Phas... 61 4e-07 gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium r... 57 4e-06 gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus g... 50 8e-06 >ref|XP_007133039.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] gi|561006039|gb|ESW05033.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] Length = 93 Score = 60.8 bits (146), Expect = 4e-07 Identities = 33/62 (53%), Positives = 37/62 (59%) Frame = +3 Query: 9 RCSVKPA*RGAHLSKDHIIQAFAKITWPNS*LGMGGPVKSHSNPTFWAETMSHHSNAPTW 188 RCSVKPA R A SK AF K+ NS LG+G P +PT A + HHSNAPTW Sbjct: 16 RCSVKPASRCALHSKSQETLAFTKVPRLNSQLGVGRPTNCKHSPTQQASMLFHHSNAPTW 75 Query: 189 VT 194 VT Sbjct: 76 VT 77 >gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium raimondii] Length = 79 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -1 Query: 130 WLFTGPPIPS*ELGHVILAKAWIMWSLERWAPRQAGFTEQRRL 2 WL +G +PS EL V AKAW++W LE APR+AGFTEQR+L Sbjct: 7 WLSSGLSVPSQELSQVSCAKAWVLWLLEWKAPREAGFTEQRKL 49 >gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus grandis] Length = 122 Score = 49.7 bits (117), Expect(2) = 8e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 139 GFEWLFTGPPIPS*ELGHVILAKAWIMWSLERWAPRQAGFTEQRR 5 G + L +GPP+PS EL HV+ AKA L+ APR+AGFTEQR+ Sbjct: 65 GLQRLLSGPPVPSRELIHVVRAKARATCVLKWRAPREAGFTEQRK 109 Score = 26.6 bits (57), Expect(2) = 8e-06 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 200 QACNPSGGIGVMGHG 156 +AC+PSGGI V+G G Sbjct: 44 RACDPSGGIKVVGRG 58