BLASTX nr result
ID: Gardenia21_contig00002944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00002944 (905 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006474598.1| PREDICTED: peroxiredoxin Q, chloroplastic-li... 105 5e-20 ref|XP_006452869.1| hypothetical protein CICLE_v10009453mg [Citr... 105 5e-20 ref|XP_008463093.1| PREDICTED: peroxiredoxin Q, chloroplastic [C... 103 2e-19 ref|XP_004138385.1| PREDICTED: peroxiredoxin Q, chloroplastic [C... 103 2e-19 gb|AFK46210.1| unknown [Lotus japonicus] 103 2e-19 gb|AFK37225.1| unknown [Lotus japonicus] 103 2e-19 ref|XP_011039927.1| PREDICTED: peroxiredoxin Q, chloroplastic [P... 103 2e-19 gb|ACJ84201.1| unknown [Medicago truncatula] 102 4e-19 ref|XP_007012557.1| Thioredoxin superfamily protein, Q [Theobrom... 102 4e-19 ref|XP_004508027.1| PREDICTED: peroxiredoxin Q, chloroplastic [C... 102 4e-19 ref|XP_003609961.2| thioredoxin-dependent peroxidase [Medicago t... 102 4e-19 emb|CDP03042.1| unnamed protein product [Coffea canephora] 102 5e-19 sp|Q75SY5.1|PRXQ_GENTR RecName: Full=Peroxiredoxin Q, chloroplas... 102 5e-19 ref|XP_004287666.1| PREDICTED: peroxiredoxin Q, chloroplastic [F... 101 7e-19 ref|XP_010425271.1| PREDICTED: peroxiredoxin Q, chloroplastic [C... 101 9e-19 ref|XP_010502503.1| PREDICTED: peroxiredoxin Q, chloroplastic-li... 101 9e-19 ref|XP_010502502.1| PREDICTED: peroxiredoxin Q, chloroplastic-li... 101 9e-19 gb|KFK33840.1| hypothetical protein AALP_AA5G066600 [Arabis alpina] 101 9e-19 ref|NP_189235.1| peroxiredoxin Q [Arabidopsis thaliana] gi|75274... 101 9e-19 ref|XP_006291823.1| hypothetical protein CARUB_v10017999mg [Caps... 101 9e-19 >ref|XP_006474598.1| PREDICTED: peroxiredoxin Q, chloroplastic-like [Citrus sinensis] Length = 215 Score = 105 bits (262), Expect = 5e-20 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDSSS KAFAKKYRLPYTLLSDEGNKVRK Sbjct: 113 QACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRK 165 >ref|XP_006452869.1| hypothetical protein CICLE_v10009453mg [Citrus clementina] gi|557556095|gb|ESR66109.1| hypothetical protein CICLE_v10009453mg [Citrus clementina] gi|641855013|gb|KDO73807.1| hypothetical protein CISIN_1g028030mg [Citrus sinensis] Length = 215 Score = 105 bits (262), Expect = 5e-20 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDSSS KAFAKKYRLPYTLLSDEGNKVRK Sbjct: 113 QACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRK 165 >ref|XP_008463093.1| PREDICTED: peroxiredoxin Q, chloroplastic [Cucumis melo] Length = 215 Score = 103 bits (257), Expect = 2e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEV+GISGDDSSS KAFAKKYRLP+TLLSDEGNKVRK Sbjct: 113 QACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDEGNKVRK 165 >ref|XP_004138385.1| PREDICTED: peroxiredoxin Q, chloroplastic [Cucumis sativus] gi|700190653|gb|KGN45857.1| hypothetical protein Csa_6G014770 [Cucumis sativus] Length = 215 Score = 103 bits (257), Expect = 2e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEV+GISGDDSSS KAFAKKYRLP+TLLSDEGNKVRK Sbjct: 113 QACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDEGNKVRK 165 >gb|AFK46210.1| unknown [Lotus japonicus] Length = 226 Score = 103 bits (257), Expect = 2e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEV+GISGDDSSS KAFAKKYRLP+TLLSDEGNKVRK Sbjct: 124 QACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDEGNKVRK 176 >gb|AFK37225.1| unknown [Lotus japonicus] Length = 224 Score = 103 bits (257), Expect = 2e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEV+GISGDDSSS KAFAKKYRLP+TLLSDEGNKVRK Sbjct: 122 QACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDEGNKVRK 174 >ref|XP_011039927.1| PREDICTED: peroxiredoxin Q, chloroplastic [Populus euphratica] Length = 213 Score = 103 bits (256), Expect = 2e-19 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEV+GISGDDSSS KAFAKKYRLP+TLLSDEGNK+RK Sbjct: 111 QACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDEGNKIRK 163 >gb|ACJ84201.1| unknown [Medicago truncatula] Length = 221 Score = 102 bits (254), Expect = 4e-19 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEV+GISGDDSSS KAFAKKY+LP+TLLSDEGNKVRK Sbjct: 119 QACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYKLPFTLLSDEGNKVRK 171 >ref|XP_007012557.1| Thioredoxin superfamily protein, Q [Theobroma cacao] gi|508782920|gb|EOY30176.1| Thioredoxin superfamily protein, Q [Theobroma cacao] Length = 216 Score = 102 bits (254), Expect = 4e-19 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEV+GISGDD+SS KAFAKKYRLP+TLLSDEGNKVRK Sbjct: 114 QACAFRDSYEKFKKAGAEVVGISGDDTSSHKAFAKKYRLPFTLLSDEGNKVRK 166 >ref|XP_004508027.1| PREDICTED: peroxiredoxin Q, chloroplastic [Cicer arietinum] Length = 220 Score = 102 bits (254), Expect = 4e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDSSS KAFAKKYRLP++LLSDEGNKVRK Sbjct: 118 QACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPFSLLSDEGNKVRK 170 >ref|XP_003609961.2| thioredoxin-dependent peroxidase [Medicago truncatula] gi|388516859|gb|AFK46491.1| unknown [Medicago truncatula] gi|657391077|gb|AES92158.2| thioredoxin-dependent peroxidase [Medicago truncatula] Length = 221 Score = 102 bits (254), Expect = 4e-19 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEV+GISGDDSSS KAFAKKY+LP+TLLSDEGNKVRK Sbjct: 119 QACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYKLPFTLLSDEGNKVRK 171 >emb|CDP03042.1| unnamed protein product [Coffea canephora] Length = 214 Score = 102 bits (253), Expect = 5e-19 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDD SS KAFAKKYRLP+TLLSDEGNKVRK Sbjct: 112 QACAFRDSYEKFKKAGAEVIGISGDDPSSHKAFAKKYRLPFTLLSDEGNKVRK 164 >sp|Q75SY5.1|PRXQ_GENTR RecName: Full=Peroxiredoxin Q, chloroplastic; AltName: Full=Thioredoxin reductase; Flags: Precursor [Gentiana triflora] gi|39748708|dbj|BAD04985.1| peroxiredoxin Q [Gentiana triflora] Length = 217 Score = 102 bits (253), Expect = 5e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDD SS KAFAKKYRLPYTLLSDEGNK+R+ Sbjct: 115 QACAFRDSYEKFKKAGAEVIGISGDDPSSHKAFAKKYRLPYTLLSDEGNKIRR 167 >ref|XP_004287666.1| PREDICTED: peroxiredoxin Q, chloroplastic [Fragaria vesca subsp. vesca] Length = 212 Score = 101 bits (252), Expect = 7e-19 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGA+V+GISGDDS+S KAFAKKY+LPYTLLSDEGNKVRK Sbjct: 110 QACAFRDSYEKFKKAGAQVVGISGDDSASHKAFAKKYKLPYTLLSDEGNKVRK 162 >ref|XP_010425271.1| PREDICTED: peroxiredoxin Q, chloroplastic [Camelina sativa] Length = 217 Score = 101 bits (251), Expect = 9e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDS+S KAFA KY+LPYTLLSDEGNKVRK Sbjct: 115 QACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRK 167 >ref|XP_010502503.1| PREDICTED: peroxiredoxin Q, chloroplastic-like isoform X2 [Camelina sativa] Length = 218 Score = 101 bits (251), Expect = 9e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDS+S KAFA KY+LPYTLLSDEGNKVRK Sbjct: 116 QACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRK 168 >ref|XP_010502502.1| PREDICTED: peroxiredoxin Q, chloroplastic-like isoform X1 [Camelina sativa] Length = 219 Score = 101 bits (251), Expect = 9e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDS+S KAFA KY+LPYTLLSDEGNKVRK Sbjct: 117 QACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRK 169 >gb|KFK33840.1| hypothetical protein AALP_AA5G066600 [Arabis alpina] Length = 212 Score = 101 bits (251), Expect = 9e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDS+S KAFA KY+LPYTLLSDEGNKVRK Sbjct: 110 QACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRK 162 >ref|NP_189235.1| peroxiredoxin Q [Arabidopsis thaliana] gi|75274189|sp|Q9LU86.1|PRXQ_ARATH RecName: Full=Peroxiredoxin Q, chloroplastic; AltName: Full=Thioredoxin reductase; Flags: Precursor gi|9279611|dbj|BAB01069.1| peroxiredoxin Q-like protein [Arabidopsis thaliana] gi|15081743|gb|AAK82526.1| AT3g26060/MPE11_21 [Arabidopsis thaliana] gi|18252273|gb|AAL62017.1| AT3g26060/MPE11_21 [Arabidopsis thaliana] gi|332643588|gb|AEE77109.1| peroxiredoxin Q [Arabidopsis thaliana] Length = 216 Score = 101 bits (251), Expect = 9e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDS+S KAFA KY+LPYTLLSDEGNKVRK Sbjct: 114 QACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRK 166 >ref|XP_006291823.1| hypothetical protein CARUB_v10017999mg [Capsella rubella] gi|482560530|gb|EOA24721.1| hypothetical protein CARUB_v10017999mg [Capsella rubella] Length = 216 Score = 101 bits (251), Expect = 9e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 161 QACAFRDSYEKFKKAGAEVIGISGDDSSSLKAFAKKYRLPYTLLSDEGNKVRK 3 QACAFRDSYEKFKKAGAEVIGISGDDS+S KAFA KY+LPYTLLSDEGNKVRK Sbjct: 114 QACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRK 166