BLASTX nr result
ID: Gardenia21_contig00002890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00002890 (557 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12853.1| unnamed protein product [Coffea canephora] 56 2e-06 >emb|CDP12853.1| unnamed protein product [Coffea canephora] Length = 433 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -1 Query: 413 EITQQATLNRNIVDSNAEVPALNVKHDLPMVFGKKYAEEEFDKRGFK 273 E +QA LN+++VD AEV AL+ MVFGKKYA++EFD+RGFK Sbjct: 91 ESLKQAALNQDVVDIGAEVAALSANMTCLMVFGKKYADKEFDERGFK 137 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = -3 Query: 270 KVFDEFLERI 241 K+FDEFLE+I Sbjct: 176 KIFDEFLEKI 185