BLASTX nr result
ID: Gardenia21_contig00002467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00002467 (282 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14289.1| unnamed protein product [Coffea canephora] 71 3e-10 >emb|CDP14289.1| unnamed protein product [Coffea canephora] Length = 108 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 168 MASMTMTASFLGGSAITKPLPTSATGRRGALVVKASKV 281 MASMTMTASFLGGSAITKPLPT+A GRRGALVVKASKV Sbjct: 1 MASMTMTASFLGGSAITKPLPTAAAGRRGALVVKASKV 38