BLASTX nr result
ID: Gardenia21_contig00002459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00002459 (703 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG54793.1| plasma membrance protein3 [Puccinellia tenuiflor... 106 2e-20 gb|ADV02768.1| putative low temperature and salt responsive prot... 106 2e-20 ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycin... 105 2e-20 gb|KQK15031.1| hypothetical protein BRADI_1g20220 [Brachypodium ... 105 4e-20 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 105 4e-20 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 105 4e-20 gb|KGN65991.1| hypothetical protein Csa_1G560745 [Cucumis sativus] 104 5e-20 ref|XP_014511134.1| PREDICTED: hydrophobic protein RCI2B [Vigna ... 104 6e-20 gb|KCW82305.1| hypothetical protein EUGRSUZ_C03713 [Eucalyptus g... 104 6e-20 gb|KCW44804.1| hypothetical protein EUGRSUZ_L01633, partial [Euc... 104 6e-20 ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 103 8e-20 ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A [Fragar... 103 8e-20 gb|ACU14681.1| unknown [Glycine max] 103 8e-20 gb|ACU14391.1| unknown [Glycine max] gi|734389210|gb|KHN26202.1|... 103 8e-20 gb|AAV88601.1| low temperature and salt responsive protein [Cenc... 103 8e-20 ref|XP_010094907.1| Hydrophobic protein LTI6A [Morus notabilis] ... 103 1e-19 ref|XP_011087564.1| PREDICTED: hydrophobic protein RCI2B [Sesamu... 103 1e-19 ref|XP_010271058.1| PREDICTED: hydrophobic protein RCI2B [Nelumb... 103 1e-19 gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indi... 103 1e-19 ref|XP_009412350.1| PREDICTED: hydrophobic protein RCI2B [Musa a... 103 1e-19 >dbj|BAG54793.1| plasma membrance protein3 [Puccinellia tenuiflora] gi|326525641|dbj|BAJ88867.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|473798548|gb|EMS46527.1| Hydrophobic protein LTI6A [Triticum urartu] gi|475526762|gb|EMT07358.1| Hydrophobic protein LTI6A [Aegilops tauschii] Length = 57 Score = 106 bits (264), Expect = 2e-20 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA GTANC+DII+AI+LPPLGVF KF C +EFWICLLLT FGYLPGIIYAVWVITK Sbjct: 1 MADEGTANCIDIILAIILPPLGVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 57 >gb|ADV02768.1| putative low temperature and salt responsive protein isoform 1 [Ipomoea batatas] gi|317134413|gb|ADV02769.1| putative low temperature and salt responsive protein isoform 2 [Ipomoea batatas] Length = 57 Score = 106 bits (264), Expect = 2e-20 Identities = 44/57 (77%), Positives = 53/57 (92%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA G TA C+DI++AI+LPPLGVFLKFGCQVEFWIC LLT+FG+LPGI+YA+WV+TK Sbjct: 1 MADGSTATCIDILLAIILPPLGVFLKFGCQVEFWICCLLTLFGWLPGIVYAIWVLTK 57 >ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max] Length = 104 Score = 105 bits (263), Expect = 2e-20 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +3 Query: 72 KMAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 KMAG G A C+DI++AI+LPPLGVFLK+GCQVEFWICL+LT+FGY+PGIIYAV+ ITK Sbjct: 47 KMAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYAITK 104 >gb|KQK15031.1| hypothetical protein BRADI_1g20220 [Brachypodium distachyon] Length = 57 Score = 105 bits (261), Expect = 4e-20 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA GTANC+DII+AI+LPPLGVF KF C +EFWICLLLT FGYLPGIIYAVWVIT+ Sbjct: 1 MADEGTANCIDIILAIILPPLGVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITR 57 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|641837447|gb|KDO56401.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] gi|641837448|gb|KDO56402.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] Length = 58 Score = 105 bits (261), Expect = 4e-20 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA GTA C+DII+AI+LPPLGVFLKFGC+VEFWICLLLTIFGY+PGIIYAV+ ITK Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 105 bits (261), Expect = 4e-20 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA GTANC+DI++AI+LPPLGVFLKFGC++EFWICLLLT+FGY+PGIIYAV+ ITK Sbjct: 1 MADKGTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLTLFGYIPGIIYAVYAITK 57 >gb|KGN65991.1| hypothetical protein Csa_1G560745 [Cucumis sativus] Length = 57 Score = 104 bits (260), Expect = 5e-20 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA GT NC+DI++AILLPPLGVFLKFGCQVEFWICL+LT FGY+PGIIYAV+ ITK Sbjct: 1 MADEGTTNCIDILLAILLPPLGVFLKFGCQVEFWICLVLTFFGYIPGIIYAVYAITK 57 >ref|XP_014511134.1| PREDICTED: hydrophobic protein RCI2B [Vigna radiata var. radiata] gi|920692191|gb|KOM35416.1| hypothetical protein LR48_Vigan02g156600 [Vigna angularis] Length = 57 Score = 104 bits (259), Expect = 6e-20 Identities = 44/57 (77%), Positives = 54/57 (94%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MAG GTA C+DI++AI+LPPLGVFLK+GC+VEFWICL+LT+FGY+PGIIYAV+ ITK Sbjct: 1 MAGDGTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|KCW82305.1| hypothetical protein EUGRSUZ_C03713 [Eucalyptus grandis] Length = 142 Score = 104 bits (259), Expect = 6e-20 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +3 Query: 72 KMAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 KMA GT NC+DI++AI+LPPLGVFLKFGCQVEFWICL+LT+FG++PGIIYAV+ ITK Sbjct: 85 KMADEGTMNCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLFGWIPGIIYAVYAITK 142 >gb|KCW44804.1| hypothetical protein EUGRSUZ_L01633, partial [Eucalyptus grandis] Length = 117 Score = 104 bits (259), Expect = 6e-20 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +3 Query: 72 KMAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 KMA GT NC+DI++AI+LPPLGVFLKFGCQVEFWICL+LT+FG++PGIIYAV+ ITK Sbjct: 60 KMADEGTMNCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLFGWIPGIIYAVYAITK 117 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 103 bits (258), Expect = 8e-20 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA GTANC+DI++AILLPPLGVFLKFGC VEFWICL+LT FGY+PGIIYA++ ITK Sbjct: 1 MADEGTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFFGYIPGIIYAIYAITK 57 >ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A [Fragaria vesca subsp. vesca] Length = 57 Score = 103 bits (258), Expect = 8e-20 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 M GTAN +DIIIAILLPPLGVFLKFGC VEFWICLLLTIFGY+PGIIYA++VITK Sbjct: 1 MPSEGTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIYVITK 57 >gb|ACU14681.1| unknown [Glycine max] Length = 57 Score = 103 bits (258), Expect = 8e-20 Identities = 44/57 (77%), Positives = 53/57 (92%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MAG G A C+DI++AI+LPPLGVFLK+GCQVEFWICL+LT+FGY+PGIIYAV+ ITK Sbjct: 1 MAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYTITK 57 >gb|ACU14391.1| unknown [Glycine max] gi|734389210|gb|KHN26202.1| Hydrophobic protein LTI6A [Glycine soja] gi|947040720|gb|KRG90444.1| hypothetical protein GLYMA_20G091300 [Glycine max] Length = 57 Score = 103 bits (258), Expect = 8e-20 Identities = 44/57 (77%), Positives = 53/57 (92%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MAG G A C+DI++AI+LPPLGVFLK+GCQVEFWICL+LT+FGY+PGIIYAV+ ITK Sbjct: 1 MAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|AAV88601.1| low temperature and salt responsive protein [Cenchrus americanus] Length = 56 Score = 103 bits (258), Expect = 8e-20 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +3 Query: 87 GTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 GTANC+DII+AI+LPPLGVF KFGC VEFWICL+LT FGYLPGIIYAVW ITK Sbjct: 4 GTANCIDIILAIILPPLGVFFKFGCGVEFWICLVLTFFGYLPGIIYAVWAITK 56 >ref|XP_010094907.1| Hydrophobic protein LTI6A [Morus notabilis] gi|587868183|gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] Length = 57 Score = 103 bits (257), Expect = 1e-19 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 M G G+A CVDI++AI+LPPLGVFLKFGC+ EFWICLLLT+FGYLPGIIYAV++ITK Sbjct: 1 MRGQGSATCVDILLAIILPPLGVFLKFGCRAEFWICLLLTLFGYLPGIIYAVYIITK 57 >ref|XP_011087564.1| PREDICTED: hydrophobic protein RCI2B [Sesamum indicum] Length = 57 Score = 103 bits (257), Expect = 1e-19 Identities = 44/55 (80%), Positives = 52/55 (94%) Frame = +3 Query: 81 GGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 G GTA C+DI++AI+LPPLGVFLKFGC+VEFWICLLLTIFGY+PGIIYA++ ITK Sbjct: 2 GDGTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAIYAITK 56 >ref|XP_010271058.1| PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 103 bits (257), Expect = 1e-19 Identities = 44/57 (77%), Positives = 53/57 (92%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA GTA C+DI++AI+LPPLGVFLKFGC+VEFWICLLLT+FGY+PGIIYA++ ITK Sbjct: 1 MASEGTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLFGYIPGIIYAIYAITK 57 >gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group] gi|222618224|gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group] Length = 56 Score = 103 bits (257), Expect = 1e-19 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = +3 Query: 87 GTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 GTANC+DI+IAI+LPPLGVFLKFGC+VEFW+CLLLT FGYLPGIIYAV+ ITK Sbjct: 4 GTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFFGYLPGIIYAVYAITK 56 >ref|XP_009412350.1| PREDICTED: hydrophobic protein RCI2B [Musa acuminata subsp. malaccensis] Length = 57 Score = 103 bits (256), Expect = 1e-19 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = +3 Query: 75 MAGGGTANCVDIIIAILLPPLGVFLKFGCQVEFWICLLLTIFGYLPGIIYAVWVITK 245 MA GTA C++I++AI+LPPLGVFLKFGC+VEFWICLLLT+FGYLPGIIYAV+ ITK Sbjct: 1 MANQGTARCIEILLAIILPPLGVFLKFGCKVEFWICLLLTLFGYLPGIIYAVYAITK 57