BLASTX nr result
ID: Gardenia21_contig00002096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00002096 (398 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP16060.1| unnamed protein product [Coffea canephora] 76 9e-12 ref|XP_009757618.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_009602216.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_012830908.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 gb|EYU42849.1| hypothetical protein MIMGU_mgv1a0029292mg, partia... 64 6e-08 ref|XP_011100440.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006357891.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_004243629.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >emb|CDP16060.1| unnamed protein product [Coffea canephora] Length = 558 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -3 Query: 120 TSNGNLMDGNVKICKRAEVVCLGMLAPRKFTQRRKKVEFF 1 +SNGN MDGN+KICKRAEVVCLGMLAPRKF Q+RKKVE+F Sbjct: 24 SSNGNFMDGNLKICKRAEVVCLGMLAPRKFMQKRKKVEYF 63 >ref|XP_009757618.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 [Nicotiana sylvestris] Length = 587 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 117 SNGNLMDGNVKICKRAEVVCLGMLAPRKFTQRRKKVEFF 1 S GNL+D NVKICKRAEVVC GMLAPRKF Q+RKKVE F Sbjct: 21 SGGNLLDTNVKICKRAEVVCQGMLAPRKFMQKRKKVEVF 59 >ref|XP_009602216.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 [Nicotiana tomentosiformis] Length = 590 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 117 SNGNLMDGNVKICKRAEVVCLGMLAPRKFTQRRKKVEFF 1 S GNL+D NVKICKRAEVVC GMLAPRKF Q+RKKVE F Sbjct: 26 SGGNLLDTNVKICKRAEVVCQGMLAPRKFMQKRKKVEVF 64 >ref|XP_012830908.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 [Erythranthe guttatus] Length = 630 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 108 NLMDGNVKICKRAEVVCLGMLAPRKFTQRRKKVEFF 1 N D NV+ICKRAEVVCLGMLAPRKF QRRKK+E F Sbjct: 29 NSADANVRICKRAEVVCLGMLAPRKFMQRRKKIEVF 64 >gb|EYU42849.1| hypothetical protein MIMGU_mgv1a0029292mg, partial [Erythranthe guttata] Length = 199 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 108 NLMDGNVKICKRAEVVCLGMLAPRKFTQRRKKVEFF 1 N D NV+ICKRAEVVCLGMLAPRKF QRRKK+E F Sbjct: 29 NSADANVRICKRAEVVCLGMLAPRKFMQRRKKIEVF 64 >ref|XP_011100440.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 [Sesamum indicum] Length = 529 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 108 NLMDGNVKICKRAEVVCLGMLAPRKFTQRRKKVEFF 1 N +DG+ +ICKRAEVVCLGMLAPRKF Q+RKKVE F Sbjct: 29 NSVDGDARICKRAEVVCLGMLAPRKFMQKRKKVEVF 64 >ref|XP_006357891.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040-like [Solanum tuberosum] Length = 576 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 117 SNGNLMDGNVKICKRAEVVCLGMLAPRKFTQRRKKVEFF 1 S N ++ NVKICKRAEVVC GML PRKF Q+R+KVE F Sbjct: 26 SGENSLNTNVKICKRAEVVCQGMLTPRKFMQKRRKVEVF 64 >ref|XP_004243629.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 [Solanum lycopersicum] Length = 580 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 117 SNGNLMDGNVKICKRAEVVCLGMLAPRKFTQRRKKVEFF 1 S N + NVKICKRAEVVC GML PRKF Q+R+KVE F Sbjct: 26 SGENSLKTNVKICKRAEVVCQGMLTPRKFMQKRRKVEVF 64