BLASTX nr result
ID: Gardenia21_contig00002064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00002064 (1031 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15714.1| unnamed protein product [Coffea canephora] 76 8e-12 >emb|CDP15714.1| unnamed protein product [Coffea canephora] Length = 81 Score = 76.3 bits (186), Expect(2) = 8e-12 Identities = 38/68 (55%), Positives = 44/68 (64%), Gaps = 3/68 (4%) Frame = +2 Query: 41 VYLSLKTCEPVVHLCRIXXXXXXXXXXXXR---SLPCKCVIYFLPFCLYFFLSWCQEVSF 211 + ++LKTCE VVHL RI SLPCK +IYFLPFCLY FLSWCQE+SF Sbjct: 14 IRITLKTCESVVHLWRISSFFFPSPSPCLPPSPSLPCKYIIYFLPFCLYIFLSWCQEISF 73 Query: 212 SLSSDLRK 235 S+SS K Sbjct: 74 SISSGEEK 81 Score = 22.7 bits (47), Expect(2) = 8e-12 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +3 Query: 3 FYLSKSKIRV 32 FYLSKSKIR+ Sbjct: 7 FYLSKSKIRI 16