BLASTX nr result
ID: Gardenia21_contig00001896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00001896 (334 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012570040.1| PREDICTED: histone H2B.3-like [Cicer arietinum] 66 9e-09 ref|XP_011094827.1| PREDICTED: histone H2B.9 [Sesamum indicum] 66 9e-09 ref|XP_010937687.1| PREDICTED: histone H2B-like [Elaeis guineens... 66 9e-09 ref|XP_010937676.1| PREDICTED: histone H2B.11-like [Elaeis guine... 66 9e-09 ref|XP_010920677.1| PREDICTED: histone H2B-like [Elaeis guineensis] 66 9e-09 ref|XP_010920668.1| PREDICTED: histone H2B.11-like [Elaeis guine... 66 9e-09 ref|XP_010260098.1| PREDICTED: histone H2B-like [Nelumbo nucifera] 66 9e-09 ref|XP_009769838.1| PREDICTED: histone H2B-like [Nicotiana sylve... 66 9e-09 ref|XP_009612958.1| PREDICTED: histone H2B-like [Nicotiana tomen... 66 9e-09 ref|XP_008810801.1| PREDICTED: histone H2B.11-like [Phoenix dact... 66 9e-09 ref|XP_008796725.1| PREDICTED: histone H2B-like [Phoenix dactyli... 66 9e-09 ref|XP_008795023.1| PREDICTED: histone H2B.11-like [Phoenix dact... 66 9e-09 ref|XP_008794946.1| PREDICTED: histone H2B.11-like [Phoenix dact... 66 9e-09 emb|CDO99820.1| unnamed protein product [Coffea canephora] 66 9e-09 ref|XP_012074887.1| PREDICTED: histone H2B [Jatropha curcas] gi|... 66 9e-09 gb|AGH68506.1| histone H2B.1, partial [Ipomoea batatas] 66 9e-09 ref|XP_004240357.1| PREDICTED: histone H2B.7-like [Solanum lycop... 66 9e-09 ref|XP_010260063.1| PREDICTED: histone H2B-like [Nelumbo nucifera] 66 1e-08 ref|XP_008807740.1| PREDICTED: histone H2B.11-like [Phoenix dact... 66 1e-08 emb|CDP06648.1| unnamed protein product [Coffea canephora] 65 2e-08 >ref|XP_012570040.1| PREDICTED: histone H2B.3-like [Cicer arietinum] Length = 126 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 35 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 66 >ref|XP_011094827.1| PREDICTED: histone H2B.9 [Sesamum indicum] Length = 137 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 46 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 77 >ref|XP_010937687.1| PREDICTED: histone H2B-like [Elaeis guineensis] gi|743842018|ref|XP_010937688.1| PREDICTED: histone H2B-like [Elaeis guineensis] gi|743842022|ref|XP_010937689.1| PREDICTED: histone H2B-like [Elaeis guineensis] Length = 149 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 58 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 89 >ref|XP_010937676.1| PREDICTED: histone H2B.11-like [Elaeis guineensis] Length = 154 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 63 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 94 >ref|XP_010920677.1| PREDICTED: histone H2B-like [Elaeis guineensis] Length = 154 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 63 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 94 >ref|XP_010920668.1| PREDICTED: histone H2B.11-like [Elaeis guineensis] Length = 154 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 63 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 94 >ref|XP_010260098.1| PREDICTED: histone H2B-like [Nelumbo nucifera] Length = 158 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 67 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 98 >ref|XP_009769838.1| PREDICTED: histone H2B-like [Nicotiana sylvestris] Length = 143 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 52 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 83 >ref|XP_009612958.1| PREDICTED: histone H2B-like [Nicotiana tomentosiformis] Length = 138 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 47 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 78 >ref|XP_008810801.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera] Length = 154 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 63 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 94 >ref|XP_008796725.1| PREDICTED: histone H2B-like [Phoenix dactylifera] Length = 153 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 62 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 93 >ref|XP_008795023.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera] Length = 154 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 63 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 94 >ref|XP_008794946.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera] Length = 154 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 63 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 94 >emb|CDO99820.1| unnamed protein product [Coffea canephora] Length = 147 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 56 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 87 >ref|XP_012074887.1| PREDICTED: histone H2B [Jatropha curcas] gi|643727027|gb|KDP35592.1| hypothetical protein JCGZ_09030 [Jatropha curcas] Length = 139 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 48 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 79 >gb|AGH68506.1| histone H2B.1, partial [Ipomoea batatas] Length = 145 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 54 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 85 >ref|XP_004240357.1| PREDICTED: histone H2B.7-like [Solanum lycopersicum] gi|565390992|ref|XP_006361212.1| PREDICTED: histone H2B.11-like [Solanum tuberosum] Length = 147 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS Sbjct: 56 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 87 >ref|XP_010260063.1| PREDICTED: histone H2B-like [Nelumbo nucifera] Length = 154 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIG+SSKAMGIMNS Sbjct: 63 SSETYKIYIFKVLKQVHPDIGVSSKAMGIMNS 94 >ref|XP_008807740.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera] Length = 149 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIYIFKVLKQVHPDIG+SSKAMGIMNS Sbjct: 58 SSETYKIYIFKVLKQVHPDIGVSSKAMGIMNS 89 >emb|CDP06648.1| unnamed protein product [Coffea canephora] Length = 136 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 96 SSETYKIYIFKVLKQVHPDIGISSKAMGIMNS 1 SSETYKIY+FKVLKQVHPDIGISSKAMGIMNS Sbjct: 45 SSETYKIYLFKVLKQVHPDIGISSKAMGIMNS 76