BLASTX nr result
ID: Gardenia21_contig00001607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00001607 (506 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14200.1| unnamed protein product [Coffea canephora] 72 2e-10 >emb|CDP14200.1| unnamed protein product [Coffea canephora] Length = 171 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 124 GFSSDSGALIKNFKLSVEKGARFPAEQAKFMEKPAKHISPK 2 GFSSDSGALIKNFKLS+EKG+R PAEQAKF+EKPAK IS K Sbjct: 121 GFSSDSGALIKNFKLSMEKGSRSPAEQAKFLEKPAKFISSK 161