BLASTX nr result
ID: Gardenia21_contig00001549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00001549 (533 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077392.1| PREDICTED: thioredoxin-like protein AAED1, c... 59 1e-06 ref|XP_011077391.1| PREDICTED: thioredoxin-like protein AAED1, c... 59 1e-06 >ref|XP_011077392.1| PREDICTED: thioredoxin-like protein AAED1, chloroplastic isoform X2 [Sesamum indicum] Length = 257 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 115 KCFNGTLLYISEVYADPSYSSYEALRFVSGVSTTFTPG 2 K F+ + EVYADPSYSSYEAL+FVSGVSTTFTPG Sbjct: 158 KAFSEQTKFKGEVYADPSYSSYEALKFVSGVSTTFTPG 195 >ref|XP_011077391.1| PREDICTED: thioredoxin-like protein AAED1, chloroplastic isoform X1 [Sesamum indicum] Length = 268 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 115 KCFNGTLLYISEVYADPSYSSYEALRFVSGVSTTFTPG 2 K F+ + EVYADPSYSSYEAL+FVSGVSTTFTPG Sbjct: 158 KAFSEQTKFKGEVYADPSYSSYEALKFVSGVSTTFTPG 195