BLASTX nr result
ID: Forsythia23_contig00045766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045766 (447 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073290.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 ref|XP_012856600.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 ref|XP_012856599.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 >ref|XP_011073290.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 [Sesamum indicum] Length = 547 Score = 83.2 bits (204), Expect = 6e-14 Identities = 45/78 (57%), Positives = 54/78 (69%), Gaps = 5/78 (6%) Frame = -1 Query: 279 MATVKRRLFS---LLPLTQTAIFIPKSHSTIPSSQPIYSKADDQMLFHILESCKLFPNLR 109 M V+RRL S L + T IF P+ +ST+ S Q +YS +DDQ LF ILESCKL P+ R Sbjct: 1 MEVVRRRLVSPGSSLRWSHTTIFTPRPYSTVASPQTLYSVSDDQKLFRILESCKLSPDFR 60 Query: 108 TAVAVHNKIIKH--GTCP 61 TAV+VH KIIKH GTCP Sbjct: 61 TAVSVHGKIIKHGYGTCP 78 >ref|XP_012856600.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 isoform X2 [Erythranthe guttatus] Length = 551 Score = 70.1 bits (170), Expect = 5e-10 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 3/70 (4%) Frame = -1 Query: 270 VKRRLFSLLP---LTQTAIFIPKSHSTIPSSQPIYSKADDQMLFHILESCKLFPNLRTAV 100 ++RRL S +P TA+F PK H T+ S Q IY DD++LF ILESCK + RTAV Sbjct: 9 LRRRLLSPVPPFRRRHTAVFTPKPHPTVASPQNIYPITDDRVLFAILESCKQPHHFRTAV 68 Query: 99 AVHNKIIKHG 70 +VH KIIKHG Sbjct: 69 SVHCKIIKHG 78 >ref|XP_012856599.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 isoform X1 [Erythranthe guttatus] Length = 554 Score = 65.1 bits (157), Expect = 2e-08 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 6/73 (8%) Frame = -1 Query: 270 VKRRLFSLLP---LTQTAIFIPKSHSTIPSSQPIY---SKADDQMLFHILESCKLFPNLR 109 ++RRL S +P TA+F PK H T+ S Q IY DD++LF ILESCK + R Sbjct: 9 LRRRLLSPVPPFRRRHTAVFTPKPHPTVASPQNIYPITEYEDDRVLFAILESCKQPHHFR 68 Query: 108 TAVAVHNKIIKHG 70 TAV+VH KIIKHG Sbjct: 69 TAVSVHCKIIKHG 81