BLASTX nr result
ID: Forsythia23_contig00045760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045760 (359 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073768.1| PREDICTED: uncharacterized protein LOC105158... 74 4e-11 >ref|XP_011073768.1| PREDICTED: uncharacterized protein LOC105158647 [Sesamum indicum] Length = 231 Score = 73.9 bits (180), Expect = 4e-11 Identities = 38/72 (52%), Positives = 48/72 (66%) Frame = -2 Query: 355 SIDSFVNNEIGSIETDDLQQTRKRDNLSEGHDDEPSARKRLVVLGDHSKPPREKRKNISS 176 S +S V N DDLQQTRKR NL EGH ++P ARKRLVVLG+ SKP + R+ + Sbjct: 122 SHNSHVTNATEIFYEDDLQQTRKRKNLFEGHYEKPPARKRLVVLGEDSKPTQSTRRKNLA 181 Query: 175 TEEPRSVFSHLQ 140 EEPR +F+H + Sbjct: 182 HEEPRPLFNHYE 193