BLASTX nr result
ID: Forsythia23_contig00045671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045671 (548 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73905.1| hypothetical protein VITISV_039777 [Vitis vinifera] 62 2e-07 >emb|CAN73905.1| hypothetical protein VITISV_039777 [Vitis vinifera] Length = 414 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/60 (51%), Positives = 35/60 (58%) Frame = +3 Query: 369 SWIPDQMSRTXXXXXXXXXXXXXXXXXXXXXXWYCLFHSRSVSRTSETGSSDPSVQVGRS 548 +W P QMSRT W+CL H+RSVSRTSETGSSDPSVQVGR+ Sbjct: 28 NWFPCQMSRTLAAILGGAAGAVALVGIVILIIWFCLSHNRSVSRTSETGSSDPSVQVGRN 87