BLASTX nr result
ID: Forsythia23_contig00045617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045617 (419 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083738.1| PREDICTED: elongation of fatty acids protein... 83 8e-14 ref|XP_012846310.1| PREDICTED: elongation of fatty acids protein... 79 1e-12 gb|EYU45106.1| hypothetical protein MIMGU_mgv1a022385mg, partial... 79 1e-12 ref|XP_009797405.1| PREDICTED: elongation of fatty acids protein... 77 4e-12 ref|XP_009595247.1| PREDICTED: elongation of fatty acids protein... 77 4e-12 ref|XP_004509237.1| PREDICTED: elongation of fatty acids protein... 76 8e-12 ref|XP_006366463.1| PREDICTED: uncharacterized protein LOC102595... 74 4e-11 ref|XP_004300594.2| PREDICTED: elongation of fatty acids protein... 74 5e-11 ref|XP_002283511.1| PREDICTED: elongation of fatty acids protein... 73 8e-11 ref|XP_009379178.1| PREDICTED: elongation of fatty acids protein... 72 1e-10 ref|XP_008440157.1| PREDICTED: uncharacterized protein LOC103484... 72 1e-10 ref|XP_008339387.1| PREDICTED: uncharacterized protein LOC103402... 72 1e-10 ref|XP_004141955.1| PREDICTED: elongation of fatty acids protein... 72 1e-10 ref|XP_010099357.1| Putative elongation of fatty acids protein [... 72 1e-10 ref|XP_008241619.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 72 1e-10 ref|XP_007202280.1| hypothetical protein PRUPE_ppa008998mg [Prun... 72 1e-10 ref|XP_010254966.1| PREDICTED: elongation of fatty acids protein... 71 2e-10 ref|XP_009374218.1| PREDICTED: elongation of fatty acids protein... 71 2e-10 ref|XP_008361373.1| PREDICTED: uncharacterized protein LOC103425... 71 2e-10 ref|XP_007047034.1| GNS1/SUR4 membrane protein family [Theobroma... 71 2e-10 >ref|XP_011083738.1| PREDICTED: elongation of fatty acids protein 3-like [Sesamum indicum] Length = 302 Score = 82.8 bits (203), Expect = 8e-14 Identities = 46/116 (39%), Positives = 55/116 (47%) Frame = +2 Query: 71 MVLQITSAMNYWLAKHPMVVYXXXXXXXXXXXXXXXLXXXXXXXXXXXXXFXXXXXXXXX 250 M L+ +N+ L++HP VVY L Sbjct: 1 MTLKFIQELNFRLSEHPSVVYFRWSPTQSWGSTWIFLITSISAYIAVSVTLHVFLLLLRR 60 Query: 251 XXXXXXXXXXAFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA AL+S TIF G+LS SVAEI DTRWFW+RSKTPFQWLLCF Sbjct: 61 RKPVPLGPIPALHSLAMALLSATIFAGILSSSVAEIRDTRWFWRRSKTPFQWLLCF 116 >ref|XP_012846310.1| PREDICTED: elongation of fatty acids protein 3-like [Erythranthe guttatus] Length = 304 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LATAL+S IF GML+ S AEI DTRWFW+RSKTPFQWLLCF Sbjct: 72 ALHSLATALLSAAIFAGMLASSAAEIRDTRWFWRRSKTPFQWLLCF 117 >gb|EYU45106.1| hypothetical protein MIMGU_mgv1a022385mg, partial [Erythranthe guttata] Length = 260 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LATAL+S IF GML+ S AEI DTRWFW+RSKTPFQWLLCF Sbjct: 57 ALHSLATALLSAAIFAGMLASSAAEIRDTRWFWRRSKTPFQWLLCF 102 >ref|XP_009797405.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana sylvestris] Length = 312 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA +LIS TIF+G+LS + AEI DTRW WQRSKTPFQWLLCF Sbjct: 75 ALHSLAMSLISATIFLGILSSATAEIRDTRWIWQRSKTPFQWLLCF 120 >ref|XP_009595247.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana tomentosiformis] Length = 301 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA +LIS TIF+G+LS + AEI DTRW WQRSKTPFQWLLCF Sbjct: 74 ALHSLAMSLISATIFLGILSSAAAEIRDTRWIWQRSKTPFQWLLCF 119 >ref|XP_004509237.1| PREDICTED: elongation of fatty acids protein 3-like [Cicer arietinum] Length = 308 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 AFH+L +LIS TIF G L +V+EI DTRWFWQRSKTPFQWLLCF Sbjct: 75 AFHSLTMSLISATIFAGTLISAVSEIRDTRWFWQRSKTPFQWLLCF 120 >ref|XP_006366463.1| PREDICTED: uncharacterized protein LOC102595316 [Solanum tuberosum] Length = 302 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+L+ LISTTIF+GML +VAEI DTRW W+RSKTP QWLLCF Sbjct: 72 ALHSLSMLLISTTIFLGMLFSAVAEIRDTRWIWRRSKTPLQWLLCF 117 >ref|XP_004300594.2| PREDICTED: elongation of fatty acids protein 3-like [Fragaria vesca subsp. vesca] Length = 393 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 AFH+L L+S TIF G+ SVAEI DTRWFW+RSKTPFQWLLCF Sbjct: 164 AFHSLLMTLLSFTIFAGITLSSVAEIRDTRWFWRRSKTPFQWLLCF 209 >ref|XP_002283511.1| PREDICTED: elongation of fatty acids protein 3-like [Vitis vinifera] Length = 301 Score = 72.8 bits (177), Expect = 8e-11 Identities = 39/109 (35%), Positives = 48/109 (44%) Frame = +2 Query: 92 AMNYWLAKHPMVVYXXXXXXXXXXXXXXXLXXXXXXXXXXXXXFXXXXXXXXXXXXXXXX 271 ++ YWLA+HP +V L Sbjct: 3 SIKYWLAEHPCIVRFRWSHSQSWGSTWSFLFTSIAAYIATAAFLHLFLLLIRRRRPVPLG 62 Query: 272 XXXAFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA ALIS IF+G+L + AEI DTRWFW+RSKTP QWL CF Sbjct: 63 PIPALHSLAMALISVLIFVGILFSAAAEIRDTRWFWRRSKTPLQWLFCF 111 >ref|XP_009379178.1| PREDICTED: elongation of fatty acids protein sre1-like [Pyrus x bretschneideri] Length = 305 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA ALIS TIF G+ S AEI +TRWFW+RSKTPFQWLLCF Sbjct: 73 AIHSLAMALISFTIFAGITLSSAAEIHETRWFWRRSKTPFQWLLCF 118 >ref|XP_008440157.1| PREDICTED: uncharacterized protein LOC103484706 [Cucumis melo] Length = 316 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+L+ ALIST I G+L S+AEI DTRWFW+RSKTPFQWLLCF Sbjct: 74 AIHSLSMALISTLISAGILLSSLAEIRDTRWFWRRSKTPFQWLLCF 119 >ref|XP_008339387.1| PREDICTED: uncharacterized protein LOC103402413 [Malus domestica] Length = 517 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA ALIS TIF G+ S AEI +TRWFW+RSKTPFQWLLCF Sbjct: 285 AIHSLAMALISFTIFAGITLSSAAEIHETRWFWRRSKTPFQWLLCF 330 >ref|XP_004141955.1| PREDICTED: elongation of fatty acids protein 3-like [Cucumis sativus] gi|700193242|gb|KGN48446.1| hypothetical protein Csa_6G487670 [Cucumis sativus] Length = 316 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+L+ ALIST I G+L S+AEI DTRWFW+RSKTPFQWLLCF Sbjct: 74 AIHSLSMALISTLISAGILLSSLAEIRDTRWFWRRSKTPFQWLLCF 119 >ref|XP_010099357.1| Putative elongation of fatty acids protein [Morus notabilis] gi|587889199|gb|EXB77878.1| Putative elongation of fatty acids protein [Morus notabilis] Length = 284 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLC 415 A H+L+ ALIS TIF G+L + AEI DTRWFW+RSKTPFQWLLC Sbjct: 66 ALHSLSMALISVTIFAGILLSAAAEIRDTRWFWRRSKTPFQWLLC 110 >ref|XP_008241619.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103340033 [Prunus mume] Length = 295 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA ALIS TIF G+ S AEI +TRWFW+RSKTPFQWLLCF Sbjct: 73 AVHSLAMALISFTIFAGITLSSAAEIRETRWFWRRSKTPFQWLLCF 118 >ref|XP_007202280.1| hypothetical protein PRUPE_ppa008998mg [Prunus persica] gi|462397811|gb|EMJ03479.1| hypothetical protein PRUPE_ppa008998mg [Prunus persica] Length = 311 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA ALIS TIF G+ S AEI +TRWFW+RSKTPFQWLLCF Sbjct: 73 AVHSLAMALISFTIFAGITLSSAAEIRETRWFWRRSKTPFQWLLCF 118 >ref|XP_010254966.1| PREDICTED: elongation of fatty acids protein 3-like [Nelumbo nucifera] Length = 300 Score = 71.2 bits (173), Expect = 2e-10 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+L+ LIS IF G+L + AEI DTRWFW+RSKTPFQWLLCF Sbjct: 66 AIHSLSMVLISVVIFFGILFSAAAEIRDTRWFWRRSKTPFQWLLCF 111 >ref|XP_009374218.1| PREDICTED: elongation of fatty acids protein sre1-like [Pyrus x bretschneideri] Length = 302 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA ALIS TIF G+ S AEI +TRWFW RSKTPFQWLLCF Sbjct: 70 AVHSLAMALISFTIFAGVTLSSAAEIRETRWFWPRSKTPFQWLLCF 115 >ref|XP_008361373.1| PREDICTED: uncharacterized protein LOC103425075 [Malus domestica] Length = 302 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 A H+LA ALIS TIF G+ S AEI +TRWFW RSKTPFQWLLCF Sbjct: 70 AVHSLAMALISFTIFAGVTLSSAAEIRETRWFWPRSKTPFQWLLCF 115 >ref|XP_007047034.1| GNS1/SUR4 membrane protein family [Theobroma cacao] gi|508699295|gb|EOX91191.1| GNS1/SUR4 membrane protein family [Theobroma cacao] Length = 283 Score = 71.2 bits (173), Expect = 2e-10 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +2 Query: 281 AFHNLATALISTTIFIGMLSFSVAEICDTRWFWQRSKTPFQWLLCF 418 AFH+L +LIS IF G+L + AEI +TRWFW+RSKTPFQWLLCF Sbjct: 67 AFHSLIMSLISAVIFAGILLSAAAEIKETRWFWRRSKTPFQWLLCF 112