BLASTX nr result
ID: Forsythia23_contig00045397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045397 (467 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082756.1| PREDICTED: TPR repeat-containing thioredoxin... 77 4e-12 ref|XP_012848612.1| PREDICTED: TPR repeat-containing thioredoxin... 76 1e-11 gb|EYU45014.1| hypothetical protein MIMGU_mgv1a0029401mg, partia... 76 1e-11 ref|XP_009794169.1| PREDICTED: TPR repeat-containing thioredoxin... 74 3e-11 ref|XP_009604807.1| PREDICTED: TPR repeat-containing thioredoxin... 74 3e-11 ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin... 74 4e-11 gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlise... 74 4e-11 ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin... 74 4e-11 ref|XP_011098231.1| PREDICTED: TPR repeat-containing thioredoxin... 73 8e-11 ref|XP_012850688.1| PREDICTED: TPR repeat-containing thioredoxin... 69 9e-10 gb|EYU26330.1| hypothetical protein MIMGU_mgv1a002333mg [Erythra... 69 9e-10 ref|XP_009386632.1| PREDICTED: TPR repeat-containing thioredoxin... 67 5e-09 emb|CDP06000.1| unnamed protein product [Coffea canephora] 67 5e-09 ref|XP_012457385.1| PREDICTED: TPR repeat-containing thioredoxin... 67 6e-09 gb|KJB13201.1| hypothetical protein B456_002G061800 [Gossypium r... 67 6e-09 ref|XP_012457374.1| PREDICTED: TPR repeat-containing thioredoxin... 67 6e-09 ref|XP_009410829.1| PREDICTED: TPR repeat-containing thioredoxin... 66 8e-09 ref|XP_011460778.1| PREDICTED: TPR repeat-containing thioredoxin... 65 1e-08 ref|XP_010644127.1| PREDICTED: TPR repeat-containing thioredoxin... 65 1e-08 ref|XP_010279112.1| PREDICTED: TPR repeat-containing thioredoxin... 65 1e-08 >ref|XP_011082756.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Sesamum indicum] Length = 701 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+I+PTFKIYRKG+RVKEMICPSPEVLESSVRHYSI Sbjct: 664 ENVRIVPTFKIYRKGARVKEMICPSPEVLESSVRHYSI 701 >ref|XP_012848612.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Erythranthe guttatus] Length = 627 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+I+PTFKIYRKG+RVKEMICPSPEVLESSVRHY+I Sbjct: 590 ENVRIVPTFKIYRKGNRVKEMICPSPEVLESSVRHYNI 627 >gb|EYU45014.1| hypothetical protein MIMGU_mgv1a0029401mg, partial [Erythranthe guttata] Length = 85 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+I+PTFKIYRKG+RVKEMICPSPEVLESSVRHY+I Sbjct: 48 ENVRIVPTFKIYRKGNRVKEMICPSPEVLESSVRHYNI 85 >ref|XP_009794169.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Nicotiana sylvestris] Length = 703 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 EN++I+PTFKIY+ GSRVKEM+CPSPEVLESSVRHYSI Sbjct: 666 ENIRIVPTFKIYKNGSRVKEMVCPSPEVLESSVRHYSI 703 >ref|XP_009604807.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Nicotiana tomentosiformis] Length = 701 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 EN++I+PTFKIY+ GSRVKEM+CPSPEVLESSVRHYSI Sbjct: 664 ENIRIVPTFKIYKNGSRVKEMVCPSPEVLESSVRHYSI 701 >ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum tuberosum] Length = 700 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+I+PTFKIY+KGSRVKEMICPS EVLESSVRHYSI Sbjct: 663 ENVRIVPTFKIYKKGSRVKEMICPSQEVLESSVRHYSI 700 >gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlisea aurea] Length = 684 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 111 ENV+I+PTFKIYRKG RVKEMICP+PEVLESSVRHYS Sbjct: 648 ENVRIVPTFKIYRKGKRVKEMICPTPEVLESSVRHYS 684 >ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Solanum lycopersicum] Length = 701 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+I+PTFKIY+KGSRVKEMICPS EVLESSVRHYSI Sbjct: 664 ENVRIVPTFKIYKKGSRVKEMICPSQEVLESSVRHYSI 701 >ref|XP_011098231.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Sesamum indicum] Length = 696 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+I+PTFKIYR GSRVKEM+CPS EVLESSVRHYSI Sbjct: 659 ENVRIVPTFKIYRNGSRVKEMVCPSQEVLESSVRHYSI 696 >ref|XP_012850688.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Erythranthe guttatus] Length = 696 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+I+PTFKIYRKG RVKE++CPS EVLES+VRHYSI Sbjct: 659 ENVRIVPTFKIYRKGIRVKEIVCPSHEVLESTVRHYSI 696 >gb|EYU26330.1| hypothetical protein MIMGU_mgv1a002333mg [Erythranthe guttata] Length = 687 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+I+PTFKIYRKG RVKE++CPS EVLES+VRHYSI Sbjct: 650 ENVRIVPTFKIYRKGIRVKEIVCPSHEVLESTVRHYSI 687 >ref|XP_009386632.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 701 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENV+++PTFKIY+ G RVKEMICPS +VLE+SVRHYS+ Sbjct: 664 ENVRVVPTFKIYKNGKRVKEMICPSQQVLENSVRHYSL 701 >emb|CDP06000.1| unnamed protein product [Coffea canephora] Length = 692 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 E+V+I+PTFKIY+ G RVKEMICPS E+LESSVRHYSI Sbjct: 655 EHVRIVPTFKIYKNGRRVKEMICPSKELLESSVRHYSI 692 >ref|XP_012457385.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X2 [Gossypium raimondii] Length = 688 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 111 ENV+I+PTFKIY+ GSRVKEM+CPS E+LE SVRHYS Sbjct: 651 ENVRIVPTFKIYKNGSRVKEMVCPSREMLEHSVRHYS 687 >gb|KJB13201.1| hypothetical protein B456_002G061800 [Gossypium raimondii] Length = 704 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 111 ENV+I+PTFKIY+ GSRVKEM+CPS E+LE SVRHYS Sbjct: 667 ENVRIVPTFKIYKNGSRVKEMVCPSREMLEHSVRHYS 703 >ref|XP_012457374.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X1 [Gossypium raimondii] gi|763745760|gb|KJB13199.1| hypothetical protein B456_002G061800 [Gossypium raimondii] Length = 702 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 111 ENV+I+PTFKIY+ GSRVKEM+CPS E+LE SVRHYS Sbjct: 665 ENVRIVPTFKIYKNGSRVKEMVCPSREMLEHSVRHYS 701 >ref|XP_009410829.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Musa acuminata subsp. malaccensis] Length = 688 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 ENVKI+PTFKIY+ G+RVKEMICPS +VLE SVRHY + Sbjct: 651 ENVKIVPTFKIYKNGTRVKEMICPSQQVLEYSVRHYGL 688 >ref|XP_011460778.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Fragaria vesca subsp. vesca] Length = 693 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 111 ENVKI+PTFKIY+ GSRVKEM+CP E+LE SVRHYS Sbjct: 656 ENVKIVPTFKIYKHGSRVKEMVCPCREMLEHSVRHYS 692 >ref|XP_010644127.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Vitis vinifera] Length = 693 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHY 108 ENV+I+PTFKIY+ GSRVKE+ICP+ EVLESSVRHY Sbjct: 656 ENVRILPTFKIYKNGSRVKEIICPTREVLESSVRHY 691 >ref|XP_010279112.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Nelumbo nucifera] Length = 716 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +1 Query: 1 ENVKIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 114 E+V+I+PTFKIY+ GSRVKEMICPS +VLE SVRHYS+ Sbjct: 679 ESVRIVPTFKIYKNGSRVKEMICPSHQVLEYSVRHYSL 716