BLASTX nr result
ID: Forsythia23_contig00045381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045381 (341 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853718.1| PREDICTED: protein trichome birefringence-li... 60 7e-07 gb|EYU23729.1| hypothetical protein MIMGU_mgv1a026953mg [Erythra... 60 7e-07 >ref|XP_012853718.1| PREDICTED: protein trichome birefringence-like 14 [Erythranthe guttatus] Length = 462 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -1 Query: 152 MKAGHLSRFFGRHSC-TVAALVLTTVFLWAGEKNPLFISLLSTEQRLRMYT 3 MK GH SR +GR S TVAALV+TT+F WA E NPL ISLLS +++ M T Sbjct: 1 MKGGHSSRIWGRQSSFTVAALVITTIFFWAWEYNPLVISLLSAQEQFIMQT 51 >gb|EYU23729.1| hypothetical protein MIMGU_mgv1a026953mg [Erythranthe guttata] Length = 481 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -1 Query: 152 MKAGHLSRFFGRHSC-TVAALVLTTVFLWAGEKNPLFISLLSTEQRLRMYT 3 MK GH SR +GR S TVAALV+TT+F WA E NPL ISLLS +++ M T Sbjct: 1 MKGGHSSRIWGRQSSFTVAALVITTIFFWAWEYNPLVISLLSAQEQFIMQT 51