BLASTX nr result
ID: Forsythia23_contig00045310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045310 (381 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO96731.1| unnamed protein product [Coffea canephora] 39 7e-06 >emb|CDO96731.1| unnamed protein product [Coffea canephora] Length = 233 Score = 38.9 bits (89), Expect(2) = 7e-06 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +3 Query: 252 EASSKKQKQNALTGLRTCNHILAM 323 +AS K QKQN TGLRTCN+ILAM Sbjct: 99 KASIKTQKQNTTTGLRTCNNILAM 122 Score = 37.4 bits (85), Expect(2) = 7e-06 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 7/32 (21%) Frame = +2 Query: 170 KEKHKRLNC-------TMKRLTQGIAEHNKAL 244 KE +RLNC TMK+LTQG+AEHNKAL Sbjct: 59 KEFIERLNCVEELARATMKKLTQGMAEHNKAL 90