BLASTX nr result
ID: Forsythia23_contig00045185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045185 (527 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012857837.1| PREDICTED: myosin-15 [Erythranthe guttatus] 57 5e-06 gb|EYU20287.1| hypothetical protein MIMGU_mgv1a000190mg [Erythra... 57 5e-06 >ref|XP_012857837.1| PREDICTED: myosin-15 [Erythranthe guttatus] Length = 1517 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 414 LEECDDDATLP*WLSNTPALLCLFQRNMCFNGFLTATS 301 L+E D+DA+LP WLSNT ALLCL QRNM NGFLTA S Sbjct: 1169 LKEGDEDASLPYWLSNTSALLCLLQRNMRSNGFLTAGS 1206 >gb|EYU20287.1| hypothetical protein MIMGU_mgv1a000190mg [Erythranthe guttata] Length = 1455 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 414 LEECDDDATLP*WLSNTPALLCLFQRNMCFNGFLTATS 301 L+E D+DA+LP WLSNT ALLCL QRNM NGFLTA S Sbjct: 1107 LKEGDEDASLPYWLSNTSALLCLLQRNMRSNGFLTAGS 1144