BLASTX nr result
ID: Forsythia23_contig00045172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045172 (410 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090863.1| PREDICTED: classical arabinogalactan protein... 51 9e-06 >ref|XP_011090863.1| PREDICTED: classical arabinogalactan protein 26-like [Sesamum indicum] Length = 137 Score = 51.2 bits (121), Expect(2) = 9e-06 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = +2 Query: 263 IPSDSTQNPDMTGPVGPDTAVAPSGLLQASSTESRFLVRELKLGTFVG 406 IPS + NPD +GPDTAVAPSG LQ SS S+ LV LKL G Sbjct: 78 IPSTRSPNPDTITSIGPDTAVAPSGSLQDSSAVSQVLVEGLKLDVLYG 125 Score = 24.6 bits (52), Expect(2) = 9e-06 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +3 Query: 78 ASFYFIVAIIMALMASSLQSLPSDQLISEFSSISSAPA 191 ++F AII+ +A SL PS QL E I++APA Sbjct: 5 SNFLAAAAIIVIFLALSL---PSHQLSLETPDIAAAPA 39