BLASTX nr result
ID: Forsythia23_contig00045162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00045162 (431 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009105634.1| PREDICTED: putative ribonuclease H protein A... 57 4e-06 >ref|XP_009105634.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica rapa] Length = 554 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/56 (42%), Positives = 35/56 (62%) Frame = +2 Query: 80 IFFVTVIHDSLPTQFNLARQGVIRDSRCKRCGGVESTLHALFWCIATTAVWKQVGW 247 +F +IH++LPT NL R+G++ ++ C RCG +E+TLH F C VW V W Sbjct: 266 LFLWKIIHNALPTGENLQRRGLLANTHCARCGEIETTLHLFFNCEFAQEVWDLVPW 321