BLASTX nr result
ID: Forsythia23_contig00044969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00044969 (610 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007047177.1| Uncharacterized protein TCM_000563 [Theobrom... 83 9e-14 gb|KJB40248.1| hypothetical protein B456_007G053400 [Gossypium r... 82 3e-13 emb|CBI18827.3| unnamed protein product [Vitis vinifera] 66 1e-08 gb|KHN42062.1| hypothetical protein glysoja_003802 [Glycine soja] 61 5e-07 ref|XP_003611791.1| hypothetical protein MTR_5g017880 [Medicago ... 59 2e-06 >ref|XP_007047177.1| Uncharacterized protein TCM_000563 [Theobroma cacao] gi|508699438|gb|EOX91334.1| Uncharacterized protein TCM_000563 [Theobroma cacao] Length = 51 Score = 83.2 bits (204), Expect = 9e-14 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -1 Query: 451 MDAPEVQSIETSTENLPPQDDEQDKAIDECCSCFYECTDTLIDYLCCTDIC 299 M+AP QSIETST N ++DEQDKA+DECCSC Y+CT+T DYLCC ++C Sbjct: 1 MEAPATQSIETSTNNFQVEEDEQDKAVDECCSCCYDCTETCFDYLCCFNLC 51 >gb|KJB40248.1| hypothetical protein B456_007G053400 [Gossypium raimondii] Length = 51 Score = 81.6 bits (200), Expect = 3e-13 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -1 Query: 451 MDAPEVQSIETSTENLPPQDDEQDKAIDECCSCFYECTDTLIDYLCCTDIC 299 M+ P QSIETST++ ++DEQDKA+DECCSC YECT ++ DYLCC D+C Sbjct: 1 MEPPATQSIETSTKSFQVEEDEQDKAVDECCSCCYECTGSIFDYLCCCDLC 51 >emb|CBI18827.3| unnamed protein product [Vitis vinifera] Length = 52 Score = 66.2 bits (160), Expect = 1e-08 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -1 Query: 451 MDAPEVQSIETSTENLPPQ-DDEQDKAIDECCSCFYECTDTLIDYLCCTDIC 299 MD P QSIE S++ Q DEQ+K DECCSC Y CTD ID+ CCT +C Sbjct: 1 MDPPPTQSIEISSKTYDIQGQDEQEKVADECCSCCYACTDNCIDFFCCTGLC 52 >gb|KHN42062.1| hypothetical protein glysoja_003802 [Glycine soja] Length = 50 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = -1 Query: 451 MDAPEVQSIETSTENLPPQDDEQDKAIDECCSCFYECTDTLIDYLCC 311 M+ P QSIE S DD QDK I+ECCSC Y+CT L D+LCC Sbjct: 1 MEPPPSQSIEISGHGYQAGDDTQDKVINECCSCCYDCTQGLFDFLCC 47 >ref|XP_003611791.1| hypothetical protein MTR_5g017880 [Medicago truncatula] Length = 79 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = -1 Query: 451 MDAPEVQSIETSTENLPPQDDEQDKAIDECCSCFYECTDTLIDYLCCT 308 MD P+ QSI+ S P DD QDK I++CCSC Y+CT D+LCC+ Sbjct: 1 MDPPQTQSIDISN---PAGDDLQDKIINDCCSCCYDCTQGFFDFLCCS 45