BLASTX nr result
ID: Forsythia23_contig00044756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00044756 (638 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834748.1| PREDICTED: GATA transcription factor 8-like ... 63 1e-07 gb|EYU39605.1| hypothetical protein MIMGU_mgv1a011769mg [Erythra... 63 1e-07 ref|XP_011084325.1| PREDICTED: GATA transcription factor 8 [Sesa... 61 5e-07 ref|XP_011076972.1| PREDICTED: GATA transcription factor 8-like ... 61 5e-07 emb|CDO99748.1| unnamed protein product [Coffea canephora] 58 5e-06 emb|CDP19135.1| unnamed protein product [Coffea canephora] 58 5e-06 >ref|XP_012834748.1| PREDICTED: GATA transcription factor 8-like [Erythranthe guttatus] gi|848868230|ref|XP_012834749.1| PREDICTED: GATA transcription factor 8-like [Erythranthe guttatus] gi|848868232|ref|XP_012834750.1| PREDICTED: GATA transcription factor 8-like [Erythranthe guttatus] gi|848868234|ref|XP_012834752.1| PREDICTED: GATA transcription factor 8-like [Erythranthe guttatus] Length = 302 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -1 Query: 107 GPNCTDENDCGNFFDQIDDLIEFPPDNEYG-DGNLV 3 GPN DE DCGNFFDQIDDLIEFPPDNE G D NLV Sbjct: 2 GPNFMDEIDCGNFFDQIDDLIEFPPDNECGEDSNLV 37 >gb|EYU39605.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata] gi|604335718|gb|EYU39606.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata] gi|604335719|gb|EYU39607.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata] gi|604335720|gb|EYU39608.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata] Length = 271 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -1 Query: 107 GPNCTDENDCGNFFDQIDDLIEFPPDNEYG-DGNLV 3 GPN DE DCGNFFDQIDDLIEFPPDNE G D NLV Sbjct: 2 GPNFMDEIDCGNFFDQIDDLIEFPPDNECGEDSNLV 37 >ref|XP_011084325.1| PREDICTED: GATA transcription factor 8 [Sesamum indicum] Length = 333 Score = 60.8 bits (146), Expect = 5e-07 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = -1 Query: 107 GPNCTDENDCGNFFDQIDDLIEFPPDNEY--GDGNLV 3 GPN DE DCGNFFDQIDDLIEFPP+NE G GNLV Sbjct: 2 GPNFMDEIDCGNFFDQIDDLIEFPPENESGGGGGNLV 38 >ref|XP_011076972.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum] gi|747061040|ref|XP_011076974.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum] Length = 328 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 101 NCTDENDCGNFFDQIDDLIEFPPDNEYGDGNLV 3 N DE DCG+FFDQ+DDLIEFPPDN+ GDGNL+ Sbjct: 4 NFVDEIDCGSFFDQMDDLIEFPPDNDCGDGNLI 36 >emb|CDO99748.1| unnamed protein product [Coffea canephora] Length = 341 Score = 57.8 bits (138), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 107 GPNCTDENDCGNFFDQIDDLIEFPPDNEYGDG 12 GPN DE DCG+FFD IDDLIEFPP+NE G+G Sbjct: 2 GPNFVDEIDCGSFFDHIDDLIEFPPENECGNG 33 >emb|CDP19135.1| unnamed protein product [Coffea canephora] Length = 93 Score = 57.8 bits (138), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 107 GPNCTDENDCGNFFDQIDDLIEFPPDNEYGDG 12 GPN DE DCG+FFD IDDLIEFPP+NE G+G Sbjct: 2 GPNFVDEIDCGSFFDHIDDLIEFPPENECGNG 33