BLASTX nr result
ID: Forsythia23_contig00044606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00044606 (365 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096962.1| PREDICTED: sister chromatid cohesion 1 prote... 65 2e-08 ref|XP_011097494.1| PREDICTED: sister chromatid cohesion 1 prote... 63 7e-08 ref|XP_010659321.1| PREDICTED: sister chromatid cohesion 1 prote... 61 3e-07 emb|CBI24843.3| unnamed protein product [Vitis vinifera] 61 3e-07 ref|XP_012844713.1| PREDICTED: sister chromatid cohesion 1 prote... 60 7e-07 gb|EYU31343.1| hypothetical protein MIMGU_mgv1a005279mg [Erythra... 60 7e-07 ref|XP_006482841.1| PREDICTED: sister chromatid cohesion 1 prote... 56 8e-06 ref|XP_006439063.1| hypothetical protein CICLE_v100309242mg, par... 56 8e-06 >ref|XP_011096962.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Sesamum indicum] Length = 470 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 364 FSETLALKNYGLVDVHQDKPYGDITLKVTPKLFKKEFSG 248 F ETL LKNYGLVDVHQ+ PY DI+LKVTPKL K +FSG Sbjct: 432 FYETLVLKNYGLVDVHQENPYDDISLKVTPKLSKGQFSG 470 >ref|XP_011097494.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Sesamum indicum] gi|747098925|ref|XP_011097495.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Sesamum indicum] gi|747098927|ref|XP_011097496.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Sesamum indicum] gi|747098929|ref|XP_011097497.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Sesamum indicum] gi|747098931|ref|XP_011097498.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Sesamum indicum] gi|747098933|ref|XP_011097499.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Sesamum indicum] Length = 649 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 364 FSETLALKNYGLVDVHQDKPYGDITLKVTPKLFKKEFSG 248 F ETL LKNYGLVDVHQ+ PY D++LKVTPKL K ++SG Sbjct: 611 FYETLVLKNYGLVDVHQENPYDDVSLKVTPKLSKGQYSG 649 >ref|XP_010659321.1| PREDICTED: sister chromatid cohesion 1 protein 3 [Vitis vinifera] Length = 758 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 364 FSETLALKNYGLVDVHQDKPYGDITLKVTPKLFKKEF 254 F ETL LKNYGLVDV Q++PYGDITLK+TPKL K F Sbjct: 722 FFETLVLKNYGLVDVQQEEPYGDITLKMTPKLSKARF 758 >emb|CBI24843.3| unnamed protein product [Vitis vinifera] Length = 709 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 364 FSETLALKNYGLVDVHQDKPYGDITLKVTPKLFKKEF 254 F ETL LKNYGLVDV Q++PYGDITLK+TPKL K F Sbjct: 673 FFETLVLKNYGLVDVQQEEPYGDITLKMTPKLSKARF 709 >ref|XP_012844713.1| PREDICTED: sister chromatid cohesion 1 protein 3 [Erythranthe guttatus] Length = 647 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 364 FSETLALKNYGLVDVHQDKPYGDITLKVTPKLFKKEFSG 248 F ETL LKNYGL+D +Q+KPY DI L++TPKL K +FSG Sbjct: 609 FYETLVLKNYGLIDTNQEKPYDDIILRITPKLSKGQFSG 647 >gb|EYU31343.1| hypothetical protein MIMGU_mgv1a005279mg [Erythranthe guttata] Length = 490 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 364 FSETLALKNYGLVDVHQDKPYGDITLKVTPKLFKKEFSG 248 F ETL LKNYGL+D +Q+KPY DI L++TPKL K +FSG Sbjct: 452 FYETLVLKNYGLIDTNQEKPYDDIILRITPKLSKGQFSG 490 >ref|XP_006482841.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Citrus sinensis] Length = 735 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 364 FSETLALKNYGLVDVHQDKPYGDITLKVTPKLFKKE 257 F ETL LK+YGL+DV Q++PYGDITLK+TPKL K + Sbjct: 699 FFETLVLKSYGLLDVEQEQPYGDITLKLTPKLSKTD 734 >ref|XP_006439063.1| hypothetical protein CICLE_v100309242mg, partial [Citrus clementina] gi|557541259|gb|ESR52303.1| hypothetical protein CICLE_v100309242mg, partial [Citrus clementina] Length = 123 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 364 FSETLALKNYGLVDVHQDKPYGDITLKVTPKLFKKE 257 F ETL LK+YGL+DV Q++PYGDITLK+TPKL K + Sbjct: 87 FFETLVLKSYGLLDVEQEQPYGDITLKLTPKLSKTD 122