BLASTX nr result
ID: Forsythia23_contig00044591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00044591 (393 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012575241.1| PREDICTED: uncharacterized protein LOC101502... 58 2e-06 ref|XP_012573878.1| PREDICTED: uncharacterized protein LOC105852... 58 3e-06 >ref|XP_012575241.1| PREDICTED: uncharacterized protein LOC101502180 [Cicer arietinum] Length = 1089 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/56 (46%), Positives = 33/56 (58%) Frame = +3 Query: 144 SQRSFTPRYGESSSSIKFSHCKFCGKFHLGECLKFKGFGVCYHYGQAGHIRRNCPV 311 SQ +F R+ S + + C CG+FH G C + VCY YGQ GHIRR+CPV Sbjct: 433 SQSTFPQRH----SGVSATRCSTCGRFHFGNCSRDGNPKVCYQYGQIGHIRRDCPV 484 >ref|XP_012573878.1| PREDICTED: uncharacterized protein LOC105852517 [Cicer arietinum] Length = 184 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/56 (44%), Positives = 33/56 (58%) Frame = +3 Query: 144 SQRSFTPRYGESSSSIKFSHCKFCGKFHLGECLKFKGFGVCYHYGQAGHIRRNCPV 311 SQ +F R+ S + + C CG+FH G C + VCY YGQ GHIRR+CP+ Sbjct: 12 SQSTFPQRH----SGVSATRCSTCGRFHFGNCSRDGNPKVCYQYGQIGHIRRDCPI 63