BLASTX nr result
ID: Forsythia23_contig00044111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00044111 (336 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094331.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 >ref|XP_011094331.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Sesamum indicum] Length = 484 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = -3 Query: 157 ATIQTQMXXXXXXXXXXXXKDPTTITPQDLLHFFKSRVRHNPILGHLDFHLF 2 A QTQ+ K P ITP+DLLHF KSR+RH+P L HLDFHLF Sbjct: 42 AAAQTQLTQLTTLLKTHLQKSPIAITPEDLLHFLKSRLRHHPTLSHLDFHLF 93