BLASTX nr result
ID: Forsythia23_contig00043735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00043735 (364 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075585.1| PREDICTED: uncharacterized protein LOC105160... 85 2e-14 ref|XP_011070953.1| PREDICTED: zinc finger protein 91-like [Sesa... 85 2e-14 ref|XP_012847770.1| PREDICTED: uncharacterized protein LOC105967... 80 4e-13 gb|EYU28846.1| hypothetical protein MIMGU_mgv1a024011mg [Erythra... 80 4e-13 ref|XP_012855455.1| PREDICTED: zinc finger protein ZAT9-like [Er... 78 2e-12 gb|EYU22378.1| hypothetical protein MIMGU_mgv1a018487mg, partial... 78 2e-12 ref|XP_012465074.1| PREDICTED: uncharacterized protein LOC105783... 71 2e-10 gb|EPS61299.1| hypothetical protein M569_13499, partial [Genlise... 69 1e-09 ref|XP_012448265.1| PREDICTED: uncharacterized protein LOC105771... 68 2e-09 gb|EPS71098.1| hypothetical protein M569_03665 [Genlisea aurea] 68 2e-09 ref|XP_007045914.1| C2H2-like zinc finger protein, putative [The... 68 2e-09 gb|KJB50586.1| hypothetical protein B456_008G178000 [Gossypium r... 67 5e-09 ref|XP_012438523.1| PREDICTED: zinc finger protein 37-like isofo... 67 5e-09 ref|XP_012438522.1| PREDICTED: zinc finger protein 37-like isofo... 67 5e-09 gb|KDO83101.1| hypothetical protein CISIN_1g041528mg [Citrus sin... 66 8e-09 ref|XP_006483052.1| PREDICTED: uncharacterized protein DDB_G0271... 66 8e-09 ref|XP_006438809.1| hypothetical protein CICLE_v10031223mg [Citr... 66 8e-09 gb|KHN30002.1| Zinc finger protein ZAT1 [Glycine soja] 66 1e-08 ref|XP_003520110.2| PREDICTED: uncharacterized protein DDB_G0286... 66 1e-08 ref|XP_006348710.1| PREDICTED: uncharacterized protein LOC102602... 66 1e-08 >ref|XP_011075585.1| PREDICTED: uncharacterized protein LOC105160026 [Sesamum indicum] Length = 553 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/72 (55%), Positives = 45/72 (62%) Frame = -3 Query: 359 KKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETSSRTPVNKXXXXXXXXXXXXXXXX 180 KKNK HVCPFC+RVFKNGQALGGHKRSHFIGGH+E ++R V K Sbjct: 482 KKNKGHVCPFCNRVFKNGQALGGHKRSHFIGGHDENNNRIAVAKPEAPDLLDLNLPAPEE 541 Query: 179 XXXDGHGQFFPW 144 + QFFPW Sbjct: 542 GEDNERTQFFPW 553 >ref|XP_011070953.1| PREDICTED: zinc finger protein 91-like [Sesamum indicum] Length = 543 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETSSRTPVNK 228 +KKNK HVCPFC+RVFKNGQALGGHKRSHFIGGHEE + R+PV K Sbjct: 474 AKKNKGHVCPFCNRVFKNGQALGGHKRSHFIGGHEENNHRSPVVK 518 >ref|XP_012847770.1| PREDICTED: uncharacterized protein LOC105967696 [Erythranthe guttatus] Length = 509 Score = 80.5 bits (197), Expect = 4e-13 Identities = 41/76 (53%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEET-SSRTPVNKXXXXXXXXXXXXXX 186 +KK+K HVCPFCDRVFKNGQALGGHKRSHFIGGH+E +R+PV K Sbjct: 434 AKKSKGHVCPFCDRVFKNGQALGGHKRSHFIGGHDENYINRSPVEKKTEQQSDLLDLNLP 493 Query: 185 XXXXXDGH--GQFFPW 144 + + GQFF W Sbjct: 494 APEADEDYERGQFFSW 509 >gb|EYU28846.1| hypothetical protein MIMGU_mgv1a024011mg [Erythranthe guttata] Length = 513 Score = 80.5 bits (197), Expect = 4e-13 Identities = 41/76 (53%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEET-SSRTPVNKXXXXXXXXXXXXXX 186 +KK+K HVCPFCDRVFKNGQALGGHKRSHFIGGH+E +R+PV K Sbjct: 438 AKKSKGHVCPFCDRVFKNGQALGGHKRSHFIGGHDENYINRSPVEKKTEQQSDLLDLNLP 497 Query: 185 XXXXXDGH--GQFFPW 144 + + GQFF W Sbjct: 498 APEADEDYERGQFFSW 513 >ref|XP_012855455.1| PREDICTED: zinc finger protein ZAT9-like [Erythranthe guttatus] Length = 495 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 359 KKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETSSRTPVN 231 KKNK HVCPFCDRVFKNGQALGGHKRSHFIGGH E ++ N Sbjct: 411 KKNKPHVCPFCDRVFKNGQALGGHKRSHFIGGHVENNNNNNNN 453 >gb|EYU22378.1| hypothetical protein MIMGU_mgv1a018487mg, partial [Erythranthe guttata] Length = 467 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 359 KKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETSSRTPVN 231 KKNK HVCPFCDRVFKNGQALGGHKRSHFIGGH E ++ N Sbjct: 411 KKNKPHVCPFCDRVFKNGQALGGHKRSHFIGGHVENNNNNNNN 453 >ref|XP_012465074.1| PREDICTED: uncharacterized protein LOC105783906 [Gossypium raimondii] gi|763813478|gb|KJB80330.1| hypothetical protein B456_013G092400 [Gossypium raimondii] gi|763813479|gb|KJB80331.1| hypothetical protein B456_013G092400 [Gossypium raimondii] gi|763813480|gb|KJB80332.1| hypothetical protein B456_013G092400 [Gossypium raimondii] gi|763813481|gb|KJB80333.1| hypothetical protein B456_013G092400 [Gossypium raimondii] gi|763813482|gb|KJB80334.1| hypothetical protein B456_013G092400 [Gossypium raimondii] Length = 481 Score = 71.2 bits (173), Expect = 2e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETS 249 SKKNK HVCPFC RVFK+GQALGGHKRSHF GG E+T+ Sbjct: 407 SKKNKGHVCPFCFRVFKSGQALGGHKRSHFAGGSEDTT 444 >gb|EPS61299.1| hypothetical protein M569_13499, partial [Genlisea aurea] Length = 152 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 350 KVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETSS 246 K HVCPFCDRVFKNGQALGGHKRSHFIGG+ S+ Sbjct: 101 KSHVCPFCDRVFKNGQALGGHKRSHFIGGNHNNSN 135 >ref|XP_012448265.1| PREDICTED: uncharacterized protein LOC105771371 [Gossypium raimondii] gi|763793803|gb|KJB60799.1| hypothetical protein B456_009G326300 [Gossypium raimondii] Length = 503 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEE 255 SKKNK H CPFC RVFK+GQALGGHKRSHF+GG E+ Sbjct: 427 SKKNKGHQCPFCFRVFKSGQALGGHKRSHFVGGSED 462 >gb|EPS71098.1| hypothetical protein M569_03665 [Genlisea aurea] Length = 382 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -3 Query: 359 KKNKV-HVCPFCDRVFKNGQALGGHKRSHFIGGH 261 KK+K+ HVCPFCDRVFKNGQALGGHKRSHFIG H Sbjct: 303 KKSKLPHVCPFCDRVFKNGQALGGHKRSHFIGNH 336 >ref|XP_007045914.1| C2H2-like zinc finger protein, putative [Theobroma cacao] gi|508709849|gb|EOY01746.1| C2H2-like zinc finger protein, putative [Theobroma cacao] Length = 534 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEE 255 SKKNK H CPFC RVFK+GQALGGHKRSHF+GG E+ Sbjct: 462 SKKNKGHECPFCFRVFKSGQALGGHKRSHFVGGSED 497 >gb|KJB50586.1| hypothetical protein B456_008G178000 [Gossypium raimondii] Length = 462 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEE 255 SKKNK H CPFC RVFK+GQALGGHKRSHF+GG ++ Sbjct: 390 SKKNKGHECPFCFRVFKSGQALGGHKRSHFVGGSDD 425 >ref|XP_012438523.1| PREDICTED: zinc finger protein 37-like isoform X2 [Gossypium raimondii] gi|763783514|gb|KJB50585.1| hypothetical protein B456_008G178000 [Gossypium raimondii] Length = 489 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEE 255 SKKNK H CPFC RVFK+GQALGGHKRSHF+GG ++ Sbjct: 417 SKKNKGHECPFCFRVFKSGQALGGHKRSHFVGGSDD 452 >ref|XP_012438522.1| PREDICTED: zinc finger protein 37-like isoform X1 [Gossypium raimondii] gi|763783513|gb|KJB50584.1| hypothetical protein B456_008G178000 [Gossypium raimondii] Length = 493 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEE 255 SKKNK H CPFC RVFK+GQALGGHKRSHF+GG ++ Sbjct: 421 SKKNKGHECPFCFRVFKSGQALGGHKRSHFVGGSDD 456 >gb|KDO83101.1| hypothetical protein CISIN_1g041528mg [Citrus sinensis] Length = 527 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEE 255 SKK+K H CPFC RVFK+GQALGGHKRSHF+GG E+ Sbjct: 455 SKKSKGHECPFCFRVFKSGQALGGHKRSHFVGGSED 490 >ref|XP_006483052.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus sinensis] Length = 527 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEE 255 SKK+K H CPFC RVFK+GQALGGHKRSHF+GG E+ Sbjct: 455 SKKSKGHECPFCFRVFKSGQALGGHKRSHFVGGSED 490 >ref|XP_006438809.1| hypothetical protein CICLE_v10031223mg [Citrus clementina] gi|557541005|gb|ESR52049.1| hypothetical protein CICLE_v10031223mg [Citrus clementina] Length = 527 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEE 255 SKK+K H CPFC RVFK+GQALGGHKRSHF+GG E+ Sbjct: 455 SKKSKGHECPFCFRVFKSGQALGGHKRSHFVGGSED 490 >gb|KHN30002.1| Zinc finger protein ZAT1 [Glycine soja] Length = 494 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETS 249 SKK+K H CP C+++F++GQALGGHKRSHFIGG EE + Sbjct: 431 SKKSKAHECPICNKIFRSGQALGGHKRSHFIGGSEENT 468 >ref|XP_003520110.2| PREDICTED: uncharacterized protein DDB_G0286591-like [Glycine max] Length = 501 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 362 SKKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETS 249 SKK+K H CP C+++F++GQALGGHKRSHFIGG EE + Sbjct: 438 SKKSKAHECPICNKIFRSGQALGGHKRSHFIGGSEENT 475 >ref|XP_006348710.1| PREDICTED: uncharacterized protein LOC102602723 [Solanum tuberosum] Length = 529 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 359 KKNKVHVCPFCDRVFKNGQALGGHKRSHFIGGHEETSSRTPVNK 228 KK++ H CPFCDRVFK+GQALGGHKRSHFI G E+ +R+ K Sbjct: 459 KKSQRHECPFCDRVFKSGQALGGHKRSHFIVGTEQNMNRSSAVK 502