BLASTX nr result
ID: Forsythia23_contig00043525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00043525 (382 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072574.1| PREDICTED: uncharacterized protein LOC105157... 70 4e-10 gb|EYU38353.1| hypothetical protein MIMGU_mgv1a015172mg [Erythra... 62 2e-07 >ref|XP_011072574.1| PREDICTED: uncharacterized protein LOC105157792 [Sesamum indicum] Length = 421 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/71 (46%), Positives = 56/71 (78%) Frame = -2 Query: 381 EKERLMENIDNKRKDILLRKGELKRLYSEMEEMEGQVARDIVVIEELDKNIRTQTSKFQH 202 E+ R +E+IDN+ K++L RK E++RL SE++++E Q+AR++++++EL++NI TQTS+F H Sbjct: 354 ERNRRLESIDNRNKELLTRKVEVERLKSEIQDIEDQLAREVIMMDELNRNIGTQTSEFPH 413 Query: 201 LEQMPLMDRLI 169 LMD L+ Sbjct: 414 TY---LMDGLV 421 >gb|EYU38353.1| hypothetical protein MIMGU_mgv1a015172mg [Erythranthe guttata] Length = 166 Score = 62.0 bits (149), Expect = 2e-07 Identities = 24/71 (33%), Positives = 53/71 (74%) Frame = -2 Query: 381 EKERLMENIDNKRKDILLRKGELKRLYSEMEEMEGQVARDIVVIEELDKNIRTQTSKFQH 202 E+ R ++NID +++++ LRK E+++L SE+ ++E ++ ++ V+++EL+K I +T++F Sbjct: 96 ERNRRLKNIDKEKREVSLRKAEMEKLKSEIRDLEDRLVQEAVLVDELNKKISARTTRFSQ 155 Query: 201 LEQMPLMDRLI 169 L+ M ++D L+ Sbjct: 156 LQNMYVVDGLV 166