BLASTX nr result
ID: Forsythia23_contig00043454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00043454 (314 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096237.1| PREDICTED: internal alternative NAD(P)H-ubiq... 63 9e-08 >ref|XP_011096237.1| PREDICTED: internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial-like [Sesamum indicum] gi|747096617|ref|XP_011096238.1| PREDICTED: internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial-like [Sesamum indicum] gi|747096619|ref|XP_011096239.1| PREDICTED: internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial-like [Sesamum indicum] Length = 553 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -3 Query: 147 MALARIARHGFRRSSGGMGNYASERYPLCEGESAHKCHSPFNGNVT 10 MALARIAR+ +RR G MG Y ER L EG SAH+CHS F GN+T Sbjct: 1 MALARIARNAYRRHGGAMGTYTCERDVLREGASAHRCHSSFGGNIT 46