BLASTX nr result
ID: Forsythia23_contig00043406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00043406 (304 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077788.1| PREDICTED: chaperonin 60 subunit beta 4, chl... 66 1e-08 emb|CDP00506.1| unnamed protein product [Coffea canephora] 59 2e-06 ref|XP_012847715.1| PREDICTED: chaperonin 60 subunit beta 4, chl... 57 6e-06 >ref|XP_011077788.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic isoform X1 [Sesamum indicum] Length = 584 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 303 ATSVAKTFLTSDAVVIEIKEPASKRIRKPMPTSGIGPLGI 184 A SVAKTFLT+DAVVIEIKEP SK +RKP+PTSGIGP+ + Sbjct: 545 AASVAKTFLTADAVVIEIKEPVSKVLRKPIPTSGIGPVSV 584 >emb|CDP00506.1| unnamed protein product [Coffea canephora] Length = 554 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 303 ATSVAKTFLTSDAVVIEIKEPASKRI-RKPMPTSGIGPLG 187 A SVA TFLTSDAVVI+IKEP + RKP+PTSGIGP+G Sbjct: 510 AASVANTFLTSDAVVIDIKEPVPNNLMRKPLPTSGIGPIG 549 >ref|XP_012847715.1| PREDICTED: chaperonin 60 subunit beta 4, chloroplastic [Erythranthe guttatus] gi|604316724|gb|EYU28916.1| hypothetical protein MIMGU_mgv1a003338mg [Erythranthe guttata] Length = 591 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 303 ATSVAKTFLTSDAVVIEIKEPASKR-----IRKPMPTSGIGP 193 A SVAKTFLT+DAVV+EIKEP R RKPMPTSGIGP Sbjct: 545 AASVAKTFLTADAVVVEIKEPVKARPNLMGERKPMPTSGIGP 586