BLASTX nr result
ID: Forsythia23_contig00043363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00043363 (404 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094053.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 emb|CBI40590.3| unnamed protein product [Vitis vinifera] 64 4e-08 ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 emb|CAN66974.1| hypothetical protein VITISV_022076 [Vitis vinifera] 64 4e-08 ref|XP_012843871.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_004230005.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_010521548.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_006339746.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_010100697.1| hypothetical protein L484_023466 [Morus nota... 59 1e-06 ref|XP_007051479.1| Pentatricopeptide repeat (PPR) superfamily p... 57 5e-06 emb|CDP08643.1| unnamed protein product [Coffea canephora] 57 6e-06 >ref|XP_011094053.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Sesamum indicum] Length = 514 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANTTYSD 268 FIEEGG+IHKFIV+DKSHPRS+ IF +LDDVTA+MKL NT+Y D Sbjct: 458 FIEEGGRIHKFIVEDKSHPRSNQIFTMLDDVTAEMKLHGNTSYLD 502 >emb|CBI40590.3| unnamed protein product [Vitis vinifera] Length = 495 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANTTYSD 268 FIEEGG IHKFIV+D+SH RSD I+A+LD+V+ KMKL N SD Sbjct: 415 FIEEGGHIHKFIVEDRSHSRSDEIYALLDEVSMKMKLHGNVNDSD 459 >ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Vitis vinifera] Length = 512 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANTTYSD 268 FIEEGG IHKFIV+D+SH RSD I+A+LD+V+ KMKL N SD Sbjct: 458 FIEEGGHIHKFIVEDRSHSRSDEIYALLDEVSMKMKLHGNVNDSD 502 >emb|CAN66974.1| hypothetical protein VITISV_022076 [Vitis vinifera] Length = 967 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANTTYSD 268 FIEEGG IHKFIV+D+SH RSD I+A+LD+V+ KMKL N SD Sbjct: 913 FIEEGGHIHKFIVEDRSHSRSDEIYALLDEVSMKMKLHGNVNDSD 957 >ref|XP_012843871.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Erythranthe guttatus] gi|604321693|gb|EYU32269.1| hypothetical protein MIMGU_mgv1a026672mg [Erythranthe guttata] Length = 516 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDAN 283 FIEEGG IHKFIV+DKSH R D IF LD VTA+MK D N Sbjct: 459 FIEEGGLIHKFIVEDKSHERCDDIFTALDCVTAEMKFDGN 498 >ref|XP_004230005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Solanum lycopersicum] Length = 508 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANTTYSD 268 FIEEGG IHKFIV+DKSHP+S+ I+++LD VT ++K D +T D Sbjct: 458 FIEEGGDIHKFIVEDKSHPKSNEIYSLLDLVTTRLKFDVSTMEID 502 >ref|XP_010521548.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 [Tarenaya hassleriana] Length = 513 Score = 59.7 bits (143), Expect = 7e-07 Identities = 23/45 (51%), Positives = 39/45 (86%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANTTYSD 268 F+EEGG++HKF+V+DKSHP+SD I+ VL+++ +MKL+ ++ +S+ Sbjct: 458 FLEEGGEVHKFMVEDKSHPKSDEIYEVLNEIFLRMKLEKSSLFSE 502 >ref|XP_006339746.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Solanum tuberosum] Length = 508 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANT 280 FIEEGG IHKFIV+DKSHP+S+ I+++LD VT ++K D +T Sbjct: 458 FIEEGGDIHKFIVEDKSHPKSNEIYSLLDLVTTRLKFDVST 498 >ref|XP_010100697.1| hypothetical protein L484_023466 [Morus notabilis] gi|587895358|gb|EXB83859.1| hypothetical protein L484_023466 [Morus notabilis] Length = 513 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANTT 277 FIEEGG++HKFIV+DKSHPRSD I+A+L+ AK++L N T Sbjct: 461 FIEEGGQVHKFIVEDKSHPRSDEIYALLNKFYAKVRLYRNDT 502 >ref|XP_007051479.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508703740|gb|EOX95636.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 515 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKL 292 FIEEGG++HKFIV+DKSHPR D I+ +LD V+ MKL Sbjct: 460 FIEEGGRMHKFIVEDKSHPRCDEIYQILDQVSRVMKL 496 >emb|CDP08643.1| unnamed protein product [Coffea canephora] Length = 370 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -3 Query: 402 FIEEGGKIHKFIVDDKSHPRSDLIFAVLDDVTAKMKLDANTTYSD 268 F+EEGG++H+FIVDD+SHP I+A+LDDV K+KL TT D Sbjct: 316 FMEEGGQLHRFIVDDRSHPNCGQIYALLDDVHVKIKLLGYTTDID 360