BLASTX nr result
ID: Forsythia23_contig00043328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00043328 (575 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082503.1| PREDICTED: classical arabinogalactan protein... 57 8e-06 >ref|XP_011082503.1| PREDICTED: classical arabinogalactan protein 26-like [Sesamum indicum] Length = 132 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 196 NPDAMAAPGPGVTFPPEGMLPVSSTVALNLQGSVCFILVLSLVAF*LM 53 NPD +AAPGP + FPP G+LP SS++ LNL G + +LV LVAF LM Sbjct: 85 NPDVVAAPGPDMAFPPSGLLPDSSSLRLNLPGFLIPMLVSCLVAFGLM 132