BLASTX nr result
ID: Forsythia23_contig00043219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00043219 (394 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841654.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_011071678.1| PREDICTED: pentatricopeptide repeat-containi... 77 6e-12 gb|EPS64911.1| hypothetical protein M569_09864 [Genlisea aurea] 68 3e-09 ref|XP_010525201.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_006360814.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_004247664.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_004499920.2| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_003538644.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_012841654.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 [Erythranthe guttatus] Length = 734 Score = 77.0 bits (188), Expect = 4e-12 Identities = 46/119 (38%), Positives = 59/119 (49%), Gaps = 2/119 (1%) Frame = -1 Query: 352 TPLRHHHYGYTNLISASVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSYALNI 173 TPL H +T+ IS + S SYAL++ Sbjct: 23 TPLLRHQPNFTHRISTATSLPHLKQIHAHLLRNSHHSNQQQHFFHLVLSSLSFPSYALSL 82 Query: 172 LSSLHYITPP--HLANKLLKHVSRSTHPHNTLIFFQKMRKKGFPVDMFTFPTLLKAASK 2 LS + PP +N LLKH+SRS +PHNTL FFQ +++K FP+D F FP LLKAASK Sbjct: 83 LSFIPTDVPPPQQFSNNLLKHLSRSNNPHNTLFFFQAIQEKAFPIDRFCFPPLLKAASK 141 >ref|XP_011071678.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 [Sesamum indicum] Length = 730 Score = 76.6 bits (187), Expect = 6e-12 Identities = 39/64 (60%), Positives = 49/64 (76%), Gaps = 2/64 (3%) Frame = -1 Query: 187 YALNILSSL--HYITPPHLANKLLKHVSRSTHPHNTLIFFQKMRKKGFPVDMFTFPTLLK 14 YAL++LSS+ PP L++KLLKH+SRS + TLIFFQ M+KK FP+D F+FP LLK Sbjct: 74 YALSLLSSIPAQRQPPPQLSSKLLKHLSRSNNADETLIFFQTMQKKAFPIDRFSFPLLLK 133 Query: 13 AASK 2 AASK Sbjct: 134 AASK 137 >gb|EPS64911.1| hypothetical protein M569_09864 [Genlisea aurea] Length = 728 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 2/64 (3%) Frame = -1 Query: 187 YALNILSSL--HYITPPHLANKLLKHVSRSTHPHNTLIFFQKMRKKGFPVDMFTFPTLLK 14 YAL+++S L HY HL NK++ H+SRS+ N ++FFQ M +K FP+D F+FP ++K Sbjct: 72 YALSLISYLPHHYSPTFHLTNKIINHLSRSSDNRNAILFFQAMLRKDFPIDRFSFPPMIK 131 Query: 13 AASK 2 ASK Sbjct: 132 TASK 135 >ref|XP_010525201.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 [Tarenaya hassleriana] Length = 636 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/62 (45%), Positives = 45/62 (72%) Frame = -1 Query: 187 YALNILSSLHYITPPHLANKLLKHVSRSTHPHNTLIFFQKMRKKGFPVDMFTFPTLLKAA 8 YA+++ SS+H P HL N+LL+ +SRS P + L+F++++R G +D ++FP LLKAA Sbjct: 82 YAISVFSSMHSPPPSHLFNRLLRQLSRSGEPSSALLFYRRIRDAGGLLDEYSFPPLLKAA 141 Query: 7 SK 2 +K Sbjct: 142 AK 143 >ref|XP_006360814.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Solanum tuberosum] Length = 723 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/62 (50%), Positives = 41/62 (66%) Frame = -1 Query: 187 YALNILSSLHYITPPHLANKLLKHVSRSTHPHNTLIFFQKMRKKGFPVDMFTFPTLLKAA 8 Y+L+I S+L HL NKL + +SRS PHN L+F + R+ G VD F+FP LLKAA Sbjct: 73 YSLSIFSTLQN-PRTHLINKLFRELSRSKEPHNALLFLENGRRNGLEVDRFSFPPLLKAA 131 Query: 7 SK 2 S+ Sbjct: 132 SR 133 >ref|XP_004247664.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 [Solanum lycopersicum] Length = 722 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/62 (50%), Positives = 41/62 (66%) Frame = -1 Query: 187 YALNILSSLHYITPPHLANKLLKHVSRSTHPHNTLIFFQKMRKKGFPVDMFTFPTLLKAA 8 Y+L+I S+L HL NKL + +SRS PHN L+F + R+ G VD F+FP LLKAA Sbjct: 73 YSLSIFSTLQN-PRTHLINKLFRELSRSKEPHNALLFLENGRRNGLEVDRFSFPPLLKAA 131 Query: 7 SK 2 S+ Sbjct: 132 SR 133 >ref|XP_004499920.2| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Cicer arietinum] gi|828310821|ref|XP_012571154.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Cicer arietinum] Length = 738 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/63 (47%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -1 Query: 187 YALNILSSLHYITPPHLANKLLKHVSRSTHPHNTLIFFQKMR-KKGFPVDMFTFPTLLKA 11 YAL++ S T H +N+LL+H+SRS PHNTL + +R F +D F+FP LLKA Sbjct: 84 YALSVFSQFPN-TDTHFSNQLLRHLSRSPTPHNTLFLYHNLRTTNAFTLDSFSFPPLLKA 142 Query: 10 ASK 2 SK Sbjct: 143 VSK 145 >ref|XP_003538644.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Glycine max] Length = 721 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/63 (47%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = -1 Query: 187 YALNILSSLHYITPP-HLANKLLKHVSRSTHPHNTLIFFQKMRKKGFPVDMFTFPTLLKA 11 YAL++ S H PP +N+LL+ SR P NTL + +R+ GFP+D F+FP LLKA Sbjct: 67 YALSLFS--HIPNPPTRFSNQLLRQFSRGPTPENTLSLYLHLRRNGFPLDRFSFPPLLKA 124 Query: 10 ASK 2 SK Sbjct: 125 VSK 127