BLASTX nr result
ID: Forsythia23_contig00043118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00043118 (342 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090268.1| PREDICTED: protein AIR2 [Sesamum indicum] 65 1e-08 >ref|XP_011090268.1| PREDICTED: protein AIR2 [Sesamum indicum] Length = 480 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 166 IKEVNTDDDAEANEDLSLKIVQRSMIRACNGDPQKDGVSEIVTNL 32 I+ +DDDAEANEDLSLKIVQ++M+R C+ DP+ +GVSEIVTNL Sbjct: 27 IEAAISDDDAEANEDLSLKIVQKAMLRTCSIDPRSNGVSEIVTNL 71