BLASTX nr result
ID: Forsythia23_contig00041873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00041873 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088039.1| PREDICTED: uncharacterized protein LOC105169... 64 5e-08 >ref|XP_011088039.1| PREDICTED: uncharacterized protein LOC105169350 [Sesamum indicum] Length = 217 Score = 63.5 bits (153), Expect = 5e-08 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 7/68 (10%) Frame = -1 Query: 185 MTSLQLLKSSPSNSRAKF-------IAKTSTKRNLGLQNSRIVLNNGRFMVSCKLRETEN 27 M LQLLKS+PSNSR F ++ S KR++GL++S IV RF VSCK+ + + Sbjct: 1 MACLQLLKSTPSNSRTNFGCFCSELNSRASVKRSIGLRSSGIVTAYRRFRVSCKVEGSGD 60 Query: 26 QSNGEEPP 3 QSNGEEPP Sbjct: 61 QSNGEEPP 68