BLASTX nr result
ID: Forsythia23_contig00041800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00041800 (369 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009776066.1| PREDICTED: ubiquitin-like domain-containing ... 62 2e-07 ref|XP_010065369.1| PREDICTED: ubiquitin-like domain-containing ... 60 7e-07 gb|KCW62808.1| hypothetical protein EUGRSUZ_G00398 [Eucalyptus g... 60 7e-07 ref|XP_002533028.1| conserved hypothetical protein [Ricinus comm... 60 7e-07 ref|XP_010102451.1| Ubiquitin-like domain-containing CTD phospha... 59 1e-06 ref|XP_011028306.1| PREDICTED: ubiquitin-like domain-containing ... 59 1e-06 ref|XP_006384996.1| hypothetical protein POPTR_0004s229002g, par... 59 1e-06 ref|XP_009602798.1| PREDICTED: ubiquitin-like domain-containing ... 59 1e-06 ref|XP_007159568.1| hypothetical protein PHAVU_002G248400g [Phas... 59 1e-06 ref|XP_010525374.1| PREDICTED: ubiquitin-like domain-containing ... 58 2e-06 ref|NP_001241520.1| uncharacterized protein LOC100812010 [Glycin... 58 2e-06 gb|KCW62807.1| hypothetical protein EUGRSUZ_G00398 [Eucalyptus g... 58 3e-06 emb|CBI29735.3| unnamed protein product [Vitis vinifera] 57 4e-06 ref|XP_010658025.1| PREDICTED: ubiquitin-like domain-containing ... 57 4e-06 ref|XP_012066634.1| PREDICTED: ubiquitin-like domain-containing ... 57 5e-06 ref|XP_012480292.1| PREDICTED: ubiquitin-like domain-containing ... 57 6e-06 gb|KHN48090.1| Ubiquitin-like domain-containing CTD phosphatase ... 57 6e-06 gb|KHG00014.1| hypothetical protein F383_00683 [Gossypium arboreum] 57 6e-06 ref|XP_006471196.1| PREDICTED: ubiquitin-like domain-containing ... 57 6e-06 ref|XP_006431743.1| hypothetical protein CICLE_v10001794mg [Citr... 57 6e-06 >ref|XP_009776066.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Nicotiana sylvestris] Length = 336 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQEL+KLTQYLL IA DDLSFLDHK+W F+E N KR H Sbjct: 295 DQELMKLTQYLLAIADLDDLSFLDHKNWESFNEDNFKRRRH 335 >ref|XP_010065369.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Eucalyptus grandis] Length = 345 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DD S LDH++W FF+E N KR H Sbjct: 304 DQELVKLTQYLLAIADLDDFSSLDHRNWEFFNEDNAKRRRH 344 >gb|KCW62808.1| hypothetical protein EUGRSUZ_G00398 [Eucalyptus grandis] Length = 397 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DD S LDH++W FF+E N KR H Sbjct: 356 DQELVKLTQYLLAIADLDDFSSLDHRNWEFFNEDNAKRRRH 396 >ref|XP_002533028.1| conserved hypothetical protein [Ricinus communis] gi|223527190|gb|EEF29359.1| conserved hypothetical protein [Ricinus communis] Length = 339 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DD+S LDH +W FF+E N KR H Sbjct: 298 DQELVKLTQYLLAIADLDDISSLDHSNWEFFAEDNTKRRRH 338 >ref|XP_010102451.1| Ubiquitin-like domain-containing CTD phosphatase [Morus notabilis] gi|587905315|gb|EXB93487.1| Ubiquitin-like domain-containing CTD phosphatase [Morus notabilis] Length = 334 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DDLS LDH HW F+E ++KR H Sbjct: 293 DQELVKLTQYLLAIAELDDLSALDHSHWQSFTEDSVKRRRH 333 >ref|XP_011028306.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Populus euphratica] gi|743848764|ref|XP_011028307.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Populus euphratica] Length = 334 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLK 259 DQELVKLTQYLL IA DDLS LDHK+W FF+E N K Sbjct: 293 DQELVKLTQYLLAIAELDDLSVLDHKNWEFFAEGNAK 329 >ref|XP_006384996.1| hypothetical protein POPTR_0004s229002g, partial [Populus trichocarpa] gi|550341764|gb|ERP62793.1| hypothetical protein POPTR_0004s229002g, partial [Populus trichocarpa] Length = 244 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLK 259 DQELVKLTQYLL IA DDLS LDHK+W FF+E N K Sbjct: 203 DQELVKLTQYLLAIAELDDLSVLDHKNWEFFAEGNAK 239 >ref|XP_009602798.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Nicotiana tomentosiformis] Length = 336 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQEL+KLTQYLL IA DDLS LDHK+W F+E N KR H Sbjct: 295 DQELMKLTQYLLAIADLDDLSVLDHKNWESFNEDNFKRRRH 335 >ref|XP_007159568.1| hypothetical protein PHAVU_002G248400g [Phaseolus vulgaris] gi|561032983|gb|ESW31562.1| hypothetical protein PHAVU_002G248400g [Phaseolus vulgaris] Length = 333 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA FDDLS LDH W F+E N KR H Sbjct: 292 DQELVKLTQYLLAIAEFDDLSNLDHYKWELFTEDNAKRRRH 332 >ref|XP_010525374.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Tarenaya hassleriana] Length = 339 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DDLS LDH W F+E N+KR H Sbjct: 298 DQELVKLTQYLLAIAEIDDLSSLDHSRWESFTEDNVKRRRH 338 >ref|NP_001241520.1| uncharacterized protein LOC100812010 [Glycine max] gi|571453277|ref|XP_006579451.1| PREDICTED: uncharacterized protein LOC100812010 isoform X1 [Glycine max] gi|255634511|gb|ACU17619.1| unknown [Glycine max] gi|734329832|gb|KHN06487.1| Ubiquitin-like domain-containing CTD phosphatase [Glycine soja] Length = 329 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DDLS LDH +W F+E N KR H Sbjct: 288 DQELVKLTQYLLAIAELDDLSNLDHNNWELFTEDNAKRRRH 328 >gb|KCW62807.1| hypothetical protein EUGRSUZ_G00398 [Eucalyptus grandis] Length = 396 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKR 256 DQELVKLTQYLL IA DD S LDH++W FF+E N KR Sbjct: 356 DQELVKLTQYLLAIADLDDFSSLDHRNWEFFNEDNAKR 393 >emb|CBI29735.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGHN 244 DQELVKLTQYLL IA DDLS L+HK+W ++E N KR H+ Sbjct: 208 DQELVKLTQYLLAIAELDDLSSLNHKNWESYNEDNFKRRRHS 249 >ref|XP_010658025.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Vitis vinifera] gi|731411553|ref|XP_010658026.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Vitis vinifera] Length = 327 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGHN 244 DQELVKLTQYLL IA DDLS L+HK+W ++E N KR H+ Sbjct: 286 DQELVKLTQYLLAIAELDDLSSLNHKNWESYNEDNFKRRRHS 327 >ref|XP_012066634.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Jatropha curcas] gi|802562942|ref|XP_012066635.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Jatropha curcas] gi|643735991|gb|KDP42407.1| hypothetical protein JCGZ_00204 [Jatropha curcas] Length = 334 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DDL LDH W FF+E N KR H Sbjct: 293 DQELVKLTQYLLAIAEHDDLRTLDHGKWEFFTEDNTKRRRH 333 >ref|XP_012480292.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Gossypium raimondii] gi|763765192|gb|KJB32446.1| hypothetical protein B456_005G241400 [Gossypium raimondii] Length = 334 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLT+YLL IA DDLS LDH +W F++ N+KR H Sbjct: 293 DQELVKLTRYLLAIAELDDLSALDHSNWQLFTDDNVKRRRH 333 >gb|KHN48090.1| Ubiquitin-like domain-containing CTD phosphatase [Glycine soja] Length = 329 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DDLS L+H +W F+E N KR H Sbjct: 289 DQELVKLTQYLLAIAELDDLSNLEHNNWELFTEDNTKRRRH 329 >gb|KHG00014.1| hypothetical protein F383_00683 [Gossypium arboreum] Length = 334 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLT+YLL IA DDLS LDH +W F++ N+KR H Sbjct: 293 DQELVKLTRYLLAIAELDDLSALDHSNWQLFTDDNVKRRRH 333 >ref|XP_006471196.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase-like [Citrus sinensis] gi|568834218|ref|XP_006471242.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase-like [Citrus sinensis] gi|641824201|gb|KDO43551.1| hypothetical protein CISIN_1g042485mg [Citrus sinensis] Length = 332 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DDLS LDH W F+ E N KR H Sbjct: 291 DQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTKRRRH 331 >ref|XP_006431743.1| hypothetical protein CICLE_v10001794mg [Citrus clementina] gi|557533865|gb|ESR44983.1| hypothetical protein CICLE_v10001794mg [Citrus clementina] Length = 332 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = -1 Query: 369 DQELVKLTQYLLGIAAFDDLSFLDHKHWVFFSEYNLKRSGH 247 DQELVKLTQYLL IA DDLS LDH W F+ E N KR H Sbjct: 291 DQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTKRRRH 331