BLASTX nr result
ID: Forsythia23_contig00041766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00041766 (511 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJT36696.1| Ycf1, partial (chloroplast) [Syringa oblata] 47 4e-09 gb|AJT36877.1| Ycf1, partial (chloroplast) [Fraxinus hupehensis] 47 6e-09 gb|AJT36875.1| Ycf1, partial (chloroplast) [Fraxinus sp. BOP010234] 47 6e-09 gb|AJT36866.1| Ycf1, partial (chloroplast) [Fraxinus baroniana] ... 47 6e-09 gb|AJT36786.1| Ycf1, partial (chloroplast) [Fraxinus mandshurica] 47 6e-09 gb|AJT36755.1| Ycf1, partial (chloroplast) [Fraxinus paxiana] gi... 47 6e-09 gb|AJT36695.1| Ycf1, partial (chloroplast) [Syringa oblata] 47 6e-09 gb|AJT36876.1| Ycf1, partial (chloroplast) [Fraxinus excelsior v... 47 8e-09 gb|AJT36910.1| Ycf1, partial (chloroplast) [Forsythia suspensa] 48 8e-09 gb|AJT36913.1| Ycf1, partial (chloroplast) [Ligustrum sp. BOP010... 47 8e-09 gb|AJT36915.1| Ycf1, partial (chloroplast) [Ligustrum sinense] 47 8e-09 gb|AJT36754.1| Ycf1, partial (chloroplast) [Ligustrum lucidum] 47 8e-09 gb|AJT36936.1| Ycf1, partial (chloroplast) [Ligustrum quihoui] 47 8e-09 gb|AJT36914.1| Ycf1, partial (chloroplast) [Ligustrum x vicaryi] 47 8e-09 emb|CBR23797.1| Ycf1 protein [Olea europaea subsp. cuspidata] 47 1e-08 ref|YP_004563839.1| Ycf1 protein [Olea europaea subsp. cuspidata... 47 1e-08 ref|YP_004564555.1| Ycf1 protein [Olea europaea subsp. maroccana... 47 1e-08 ref|YP_004564062.1| Ycf1 protein [Olea woodiana subsp. woodiana]... 47 1e-08 ref|YP_004376479.1| Ycf1 protein [Olea europaea subsp. europaea]... 47 1e-08 ref|YP_003359417.2| Ycf1 (chloroplast) [Olea europaea] gi|291059... 47 1e-08 >gb|AJT36696.1| Ycf1, partial (chloroplast) [Syringa oblata] Length = 289 Score = 47.0 bits (110), Expect(2) = 4e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY ++E Sbjct: 113 KKTSIDNFIEKVGINRIHGIVLPDTDYHKTE 143 Score = 40.4 bits (93), Expect(2) = 4e-09 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIKK 302 Y PFLNGP RTI KSLSPSIIK+ Sbjct: 89 YDPFLNGPYRRTITKSLSPSIIKR 112 >gb|AJT36877.1| Ycf1, partial (chloroplast) [Fraxinus hupehensis] Length = 291 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY++ E Sbjct: 112 KKTSIDNFIEKVGINQIHGIVLPDTDYQKIE 142 Score = 39.7 bits (91), Expect(2) = 6e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 88 YDPFLNGPYRRTITKSLSPSIIK 110 >gb|AJT36875.1| Ycf1, partial (chloroplast) [Fraxinus sp. BOP010234] Length = 291 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY++ E Sbjct: 112 KKTSIDNFIEKVGINQIHGIVLPDTDYQKIE 142 Score = 39.7 bits (91), Expect(2) = 6e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 88 YDPFLNGPYRRTITKSLSPSIIK 110 >gb|AJT36866.1| Ycf1, partial (chloroplast) [Fraxinus baroniana] gi|766946219|gb|AJT36870.1| Ycf1, partial (chloroplast) [Fraxinus sp. BOP010228] gi|766946221|gb|AJT36871.1| Ycf1, partial (chloroplast) [Fraxinus bungeana] gi|766946225|gb|AJT36873.1| Ycf1, partial (chloroplast) [Fraxinus chinensis subsp. rhynchophylla] Length = 291 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY++ E Sbjct: 112 KKTSIDNFIEKVGINQIHGIVLPDTDYQKIE 142 Score = 39.7 bits (91), Expect(2) = 6e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 88 YDPFLNGPYRRTITKSLSPSIIK 110 >gb|AJT36786.1| Ycf1, partial (chloroplast) [Fraxinus mandshurica] Length = 291 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY++ E Sbjct: 112 KKTSIDNFIEKVGINQIHGIVLPDTDYQKIE 142 Score = 39.7 bits (91), Expect(2) = 6e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 88 YDPFLNGPYRRTITKSLSPSIIK 110 >gb|AJT36755.1| Ycf1, partial (chloroplast) [Fraxinus paxiana] gi|766946215|gb|AJT36868.1| Ycf1, partial (chloroplast) [Fraxinus velutina] gi|766946227|gb|AJT36874.1| Ycf1, partial (chloroplast) [Fraxinus pennsylvanica] gi|766946235|gb|AJT36878.1| Ycf1, partial (chloroplast) [Fraxinus americana] gi|766946241|gb|AJT36881.1| Ycf1, partial (chloroplast) [Fraxinus pennsylvanica var. subintegerrima] Length = 291 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY++ E Sbjct: 112 KKTSIDNFIEKVGINQIHGIVLPDTDYQKIE 142 Score = 39.7 bits (91), Expect(2) = 6e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 88 YDPFLNGPYRRTITKSLSPSIIK 110 >gb|AJT36695.1| Ycf1, partial (chloroplast) [Syringa oblata] Length = 289 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY ++E Sbjct: 113 KKTSIDNFIEKVGINRIHGIVLPDTDYHKTE 143 Score = 39.7 bits (91), Expect(2) = 6e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 89 YDPFLNGPYRRTITKSLSPSIIK 111 >gb|AJT36876.1| Ycf1, partial (chloroplast) [Fraxinus excelsior var. aurea] Length = 291 Score = 46.6 bits (109), Expect(2) = 8e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY++ E Sbjct: 112 KKTSIDNFIEKVGINRIHGIVLPDTDYQKIE 142 Score = 39.7 bits (91), Expect(2) = 8e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 88 YDPFLNGPYRRTITKSLSPSIIK 110 >gb|AJT36910.1| Ycf1, partial (chloroplast) [Forsythia suspensa] Length = 283 Score = 48.1 bits (113), Expect(2) = 8e-09 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEKI IN I GILLPDTDY++ E Sbjct: 105 KKTSIDNFIEKIGINRIHGILLPDTDYQKFE 135 Score = 38.1 bits (87), Expect(2) = 8e-09 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KS SPSIIK Sbjct: 81 YDPFLNGPYRRTITKSFSPSIIK 103 >gb|AJT36913.1| Ycf1, partial (chloroplast) [Ligustrum sp. BOP010277] Length = 268 Score = 46.6 bits (109), Expect(2) = 8e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY ++E Sbjct: 105 QKTSIDNFIEKVGINRIHGIVLPDTDYHKTE 135 Score = 39.7 bits (91), Expect(2) = 8e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 81 YDPFLNGPYRRTITKSLSPSIIK 103 >gb|AJT36915.1| Ycf1, partial (chloroplast) [Ligustrum sinense] Length = 267 Score = 46.6 bits (109), Expect(2) = 8e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY ++E Sbjct: 105 QKTSIDNFIEKVGINRIHGIVLPDTDYHKTE 135 Score = 39.7 bits (91), Expect(2) = 8e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 81 YDPFLNGPYRRTITKSLSPSIIK 103 >gb|AJT36754.1| Ycf1, partial (chloroplast) [Ligustrum lucidum] Length = 267 Score = 46.6 bits (109), Expect(2) = 8e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY ++E Sbjct: 105 QKTSIDNFIEKVGINRIHGIVLPDTDYHKTE 135 Score = 39.7 bits (91), Expect(2) = 8e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 81 YDPFLNGPYRRTITKSLSPSIIK 103 >gb|AJT36936.1| Ycf1, partial (chloroplast) [Ligustrum quihoui] Length = 261 Score = 46.6 bits (109), Expect(2) = 8e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY ++E Sbjct: 105 QKTSIDNFIEKVGINRIHGIVLPDTDYHKTE 135 Score = 39.7 bits (91), Expect(2) = 8e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 81 YDPFLNGPYRRTITKSLSPSIIK 103 >gb|AJT36914.1| Ycf1, partial (chloroplast) [Ligustrum x vicaryi] Length = 231 Score = 46.6 bits (109), Expect(2) = 8e-09 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESE 214 +K SIDNFIEK+ IN I GI+LPDTDY ++E Sbjct: 105 QKTSIDNFIEKVGINRIHGIVLPDTDYHKTE 135 Score = 39.7 bits (91), Expect(2) = 8e-09 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KSLSPSIIK Sbjct: 81 YDPFLNGPYRRTITKSLSPSIIK 103 >emb|CBR23797.1| Ycf1 protein [Olea europaea subsp. cuspidata] Length = 1876 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESEH-YKNYEVPCVSIHVV-FLDILTQL 145 +K SIDNFIEK+ IN I GI+LPDTDY++ E ++ +S +V FL + +L Sbjct: 531 KKTSIDNFIEKVGINRIHGIILPDTDYQKIEQKIDRFDKKPLSTEIVDFLTFINEL 586 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KS+SPSIIK Sbjct: 507 YDPFLNGPYRRTITKSVSPSIIK 529 >ref|YP_004563839.1| Ycf1 protein [Olea europaea subsp. cuspidata] gi|334085008|emb|CBJ04356.1| Ycf1 protein [Olea europaea subsp. cuspidata] Length = 1876 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESEH-YKNYEVPCVSIHVV-FLDILTQL 145 +K SIDNFIEK+ IN I GI+LPDTDY++ E ++ +S +V FL + +L Sbjct: 531 KKTSIDNFIEKVGINRIHGIILPDTDYQKIEQKIDRFDKKPLSTEIVDFLTFINEL 586 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KS+SPSIIK Sbjct: 507 YDPFLNGPYRRTITKSVSPSIIK 529 >ref|YP_004564555.1| Ycf1 protein [Olea europaea subsp. maroccana] gi|334084922|emb|CBS29308.1| Ycf1 protein [Olea europaea subsp. maroccana] Length = 1876 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESEH-YKNYEVPCVSIHVV-FLDILTQL 145 +K SIDNFIEK+ IN I GI+LPDTDY++ E ++ +S +V FL + +L Sbjct: 531 KKTSIDNFIEKVGINRIHGIILPDTDYQKIEQKIDRFDKKPLSTEIVDFLTFINEL 586 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KS+SPSIIK Sbjct: 507 YDPFLNGPYRRTITKSVSPSIIK 529 >ref|YP_004564062.1| Ycf1 protein [Olea woodiana subsp. woodiana] gi|334084717|emb|CBS29411.1| Ycf1 protein [Olea woodiana subsp. woodiana] Length = 1876 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESEH-YKNYEVPCVSIHVV-FLDILTQL 145 +K SIDNFIEK+ IN I GI+LPDTDY++ E ++ +S +V FL + +L Sbjct: 531 KKTSIDNFIEKVGINRIHGIILPDTDYQKIEQKIDRFDKKPLSTEIVDFLTFINEL 586 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KS+SPSIIK Sbjct: 507 YDPFLNGPYRRTITKSVSPSIIK 529 >ref|YP_004376479.1| Ycf1 protein [Olea europaea subsp. europaea] gi|328795491|emb|CBR30373.1| Ycf1 protein [Olea europaea subsp. europaea] Length = 1876 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESEH-YKNYEVPCVSIHVV-FLDILTQL 145 +K SIDNFIEK+ IN I GI+LPDTDY++ E ++ +S +V FL + +L Sbjct: 531 KKTSIDNFIEKVGINRIHGIILPDTDYQKIEQKIDRFDKKPLSTEIVDFLTFINEL 586 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KS+SPSIIK Sbjct: 507 YDPFLNGPYRRTITKSVSPSIIK 529 >ref|YP_003359417.2| Ycf1 (chloroplast) [Olea europaea] gi|291059312|gb|ADD72148.1| YCF1 protein [Olea europaea] gi|334084545|emb|CBR24683.1| Ycf1 protein [Olea europaea subsp. europaea] gi|363413092|gb|ADA69984.2| Ycf1 (chloroplast) [Olea europaea] gi|510934462|emb|CCQ09160.1| Ycf1 protein (chloroplast) [Olea europaea subsp. europaea] Length = 1876 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = -2 Query: 306 RKLSIDNFIEKIWINWIDGILLPDTDYEESEH-YKNYEVPCVSIHVV-FLDILTQL 145 +K SIDNFIEK+ IN I GI+LPDTDY++ E ++ +S +V FL + +L Sbjct: 531 KKTSIDNFIEKVGINRIHGIILPDTDYQKIEQKIDRFDKKPLSTEIVDFLTFINEL 586 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 373 YSPFLNGPS*RTIRKSLSPSIIK 305 Y PFLNGP RTI KS+SPSIIK Sbjct: 507 YDPFLNGPYRRTITKSVSPSIIK 529