BLASTX nr result
ID: Forsythia23_contig00041537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00041537 (409 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_085578.1| hypothetical protein ArthMp044 [Arabidopsis tha... 89 9e-16 >ref|NP_085578.1| hypothetical protein ArthMp044 [Arabidopsis thaliana] gi|45477071|sp|P92556.1|M1260_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg01260; AltName: Full=ORF205 gi|1785779|emb|CAA69809.1| unnamed protein product [Arabidopsis thaliana] Length = 205 Score = 89.4 bits (220), Expect = 9e-16 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = -1 Query: 367 FFPIFPLLAFCFYAPRPVCSAAALEFQRRYAVWILAVSRHIVFLENYY 224 F+PI PLLAFCFYAPR VC AA+LEFQRRY VWILAVSRHIVFLEN Y Sbjct: 76 FYPIIPLLAFCFYAPRLVCPAASLEFQRRYVVWILAVSRHIVFLENSY 123