BLASTX nr result
ID: Forsythia23_contig00040179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00040179 (580 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516863.1| hypothetical protein GlmaxMp14 (mitochondrio... 221 1e-55 ref|NP_064005.1| orf152 gene product (mitochondrion) [Beta vulga... 184 2e-44 >ref|YP_007516863.1| hypothetical protein GlmaxMp14 (mitochondrion) [Glycine max] gi|403311592|gb|AFR34340.1| hypothetical protein GlmaxMp14 (mitochondrion) [Glycine max] Length = 202 Score = 221 bits (564), Expect = 1e-55 Identities = 129/189 (68%), Positives = 135/189 (71%), Gaps = 15/189 (7%) Frame = +1 Query: 58 DLWDI*RSAGLEP-----------YTRGWSRSRLVVPLSMIVDSTLISCLSWIY*SRKPS 204 D WDI RSAGLE YTR WSRSRL VPLSMIVDSTLISCLSW Sbjct: 2 DCWDIRRSAGLERNPIQGAFPQPIYTRCWSRSRLAVPLSMIVDSTLISCLSW-------- 53 Query: 205 IESSNSLSEIFPPPISC----HASSFSESVPGVSQSRFAIKRGKSLYFRLGRSHHSRNSP 372 + + S++ C HAS FSESVP VSQSRFAIKRGKSL FRLGRS HS NSP Sbjct: 54 -RALHPSSQVIRYRKDCRRVSHASCFSESVPSVSQSRFAIKRGKSLDFRLGRSRHSCNSP 112 Query: 373 VHRLITRVRIQSAHSE*KKRSSWILFLNQNVYQLIPIHSVKVSTAFSRPSTKRCTMLIGI 552 VHR ITR Q AHSE KKRSSWILFLNQNVY+LIPIHSVKVST PST+RCTMLIGI Sbjct: 113 VHRSITRASSQHAHSERKKRSSWILFLNQNVYKLIPIHSVKVSTG---PSTERCTMLIGI 169 Query: 553 GKDLLVHVL 579 GKDLLVHVL Sbjct: 170 GKDLLVHVL 178 >ref|NP_064005.1| orf152 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435150|ref|YP_004222368.1| hypothetical protein BevumaM_p135 [Beta vulgaris subsp. maritima] gi|346683241|ref|YP_004842173.1| hypothetical protein BemaM_p129 [Beta macrocarpa] gi|9049307|dbj|BAA99317.1| orf152 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|54606701|dbj|BAD66724.1| orf152 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|54606745|dbj|BAD66768.1| orf152 (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905600|emb|CBJ14007.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439883|emb|CBJ17583.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148037|emb|CBJ20701.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500159|emb|CBX24978.1| hypothetical protein [Beta macrocarpa] gi|384977915|emb|CBL54139.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 152 Score = 184 bits (468), Expect = 2e-44 Identities = 105/150 (70%), Positives = 116/150 (77%), Gaps = 4/150 (2%) Frame = +1 Query: 142 MIVDSTLISCLSWIY*SRKPSIESSNSL---SEIFPPPISCHASSFSESVPGVSQSRFAI 312 MIVDSTLIS LSW+ P++ S+ + ++F HAS FSE VP VSQSRF I Sbjct: 1 MIVDSTLISSLSWV-----PNLHPSSQVIRYRKLFRR--LSHASCFSELVPSVSQSRFTI 53 Query: 313 KRGKSLYFRLGRSHHSRNSPVHRLITRVRIQSAHSE*KKRSSWILFLNQNVY-QLIPIHS 489 RGKSLYFRLGRS HSRN VHR I RVRIQSAHSE KKRSSWILFL +NVY +PIHS Sbjct: 54 TRGKSLYFRLGRSRHSRNFLVHRSIARVRIQSAHSERKKRSSWILFLKKNVYHDSMPIHS 113 Query: 490 VKVSTAFSRPSTKRCTMLIGIGKDLLVHVL 579 VKVSTAFSRPST+RCTMLIGIGKDLL+HVL Sbjct: 114 VKVSTAFSRPSTERCTMLIGIGKDLLLHVL 143