BLASTX nr result
ID: Forsythia23_contig00040081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00040081 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006341059.1| PREDICTED: arginine biosynthesis bifunctiona... 182 7e-44 ref|XP_006341058.1| PREDICTED: arginine biosynthesis bifunctiona... 182 7e-44 ref|XP_012831985.1| PREDICTED: LOW QUALITY PROTEIN: arginine bio... 181 1e-43 gb|EYU41693.1| hypothetical protein MIMGU_mgv1a009220mg [Erythra... 181 1e-43 ref|XP_011094825.1| PREDICTED: arginine biosynthesis bifunctiona... 180 4e-43 ref|XP_011094824.1| PREDICTED: arginine biosynthesis bifunctiona... 180 4e-43 ref|XP_010325881.1| PREDICTED: arginine biosynthesis bifunctiona... 179 6e-43 ref|XP_009626977.1| PREDICTED: arginine biosynthesis bifunctiona... 179 6e-43 ref|XP_009626976.1| PREDICTED: arginine biosynthesis bifunctiona... 179 6e-43 ref|XP_004246463.1| PREDICTED: arginine biosynthesis bifunctiona... 179 6e-43 ref|XP_009769042.1| PREDICTED: arginine biosynthesis bifunctiona... 177 2e-42 ref|XP_009769041.1| PREDICTED: arginine biosynthesis bifunctiona... 177 2e-42 ref|XP_002274213.2| PREDICTED: arginine biosynthesis bifunctiona... 173 3e-41 sp|A5AEC8.1|ARGJ_VITVI RecName: Full=Arginine biosynthesis bifun... 173 3e-41 gb|KMT02706.1| hypothetical protein BVRB_8g192960 isoform B [Bet... 170 4e-40 ref|XP_010687830.1| PREDICTED: arginine biosynthesis bifunctiona... 170 4e-40 ref|XP_010687828.1| PREDICTED: arginine biosynthesis bifunctiona... 170 4e-40 ref|XP_010253268.1| PREDICTED: arginine biosynthesis bifunctiona... 169 5e-40 ref|XP_011003556.1| PREDICTED: arginine biosynthesis bifunctiona... 167 2e-39 ref|XP_006376966.1| arginine biosynthesis protein ArgJ [Populus ... 167 2e-39 >ref|XP_006341059.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 470 Score = 182 bits (462), Expect = 7e-44 Identities = 84/93 (90%), Positives = 89/93 (95%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFN +KLRISLGDI+LM+ GQPLPFDRVAASNYL+K GE+HGTV Sbjct: 378 DPNWGRIACAAGYAGIPFNADKLRISLGDIVLMEAGQPLPFDRVAASNYLRKAGEVHGTV 437 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 IQISIGDGPGSGLAWGCDLSYDYVKINAEYTT Sbjct: 438 EIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 470 >ref|XP_006341058.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 472 Score = 182 bits (462), Expect = 7e-44 Identities = 84/93 (90%), Positives = 89/93 (95%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFN +KLRISLGDI+LM+ GQPLPFDRVAASNYL+K GE+HGTV Sbjct: 380 DPNWGRIACAAGYAGIPFNADKLRISLGDIVLMEAGQPLPFDRVAASNYLRKAGEVHGTV 439 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 IQISIGDGPGSGLAWGCDLSYDYVKINAEYTT Sbjct: 440 EIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 472 >ref|XP_012831985.1| PREDICTED: LOW QUALITY PROTEIN: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Erythranthe guttatus] Length = 468 Score = 181 bits (460), Expect = 1e-43 Identities = 83/93 (89%), Positives = 88/93 (94%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFNPNKLRISLGD LLM+ GQPLPFDR AAS+YL+ TGE+HGTV Sbjct: 376 DPNWGRIACAAGYAGIPFNPNKLRISLGDTLLMENGQPLPFDRAAASDYLRTTGEVHGTV 435 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 +IQISIGDGPGSG AWGCDLSYDYVKINAEYTT Sbjct: 436 LIQISIGDGPGSGQAWGCDLSYDYVKINAEYTT 468 >gb|EYU41693.1| hypothetical protein MIMGU_mgv1a009220mg [Erythranthe guttata] Length = 349 Score = 181 bits (460), Expect = 1e-43 Identities = 83/93 (89%), Positives = 88/93 (94%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFNPNKLRISLGD LLM+ GQPLPFDR AAS+YL+ TGE+HGTV Sbjct: 257 DPNWGRIACAAGYAGIPFNPNKLRISLGDTLLMENGQPLPFDRAAASDYLRTTGEVHGTV 316 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 +IQISIGDGPGSG AWGCDLSYDYVKINAEYTT Sbjct: 317 LIQISIGDGPGSGQAWGCDLSYDYVKINAEYTT 349 >ref|XP_011094825.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X2 [Sesamum indicum] Length = 441 Score = 180 bits (456), Expect = 4e-43 Identities = 84/93 (90%), Positives = 87/93 (93%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLM+ GQPLPFDR AASNYL+ TGE HGTV Sbjct: 349 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMESGQPLPFDRAAASNYLRTTGEKHGTV 408 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 +IQISIGDG GSG AWGCDLSYDYVKINAEYTT Sbjct: 409 IIQISIGDGLGSGQAWGCDLSYDYVKINAEYTT 441 >ref|XP_011094824.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X1 [Sesamum indicum] Length = 470 Score = 180 bits (456), Expect = 4e-43 Identities = 84/93 (90%), Positives = 87/93 (93%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLM+ GQPLPFDR AASNYL+ TGE HGTV Sbjct: 378 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMESGQPLPFDRAAASNYLRTTGEKHGTV 437 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 +IQISIGDG GSG AWGCDLSYDYVKINAEYTT Sbjct: 438 IIQISIGDGLGSGQAWGCDLSYDYVKINAEYTT 470 >ref|XP_010325881.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X1 [Solanum lycopersicum] Length = 472 Score = 179 bits (454), Expect = 6e-43 Identities = 83/93 (89%), Positives = 88/93 (94%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFN +KLRISLGDI+LM+ GQPLPFDRVAASNYL+K GE+HGTV Sbjct: 380 DPNWGRIACAAGYAGIPFNADKLRISLGDIVLMEAGQPLPFDRVAASNYLRKAGEVHGTV 439 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 IQISIGDG GSGLAWGCDLSYDYVKINAEYTT Sbjct: 440 EIQISIGDGSGSGLAWGCDLSYDYVKINAEYTT 472 >ref|XP_009626977.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03124} isoform X2 [Nicotiana tomentosiformis] Length = 430 Score = 179 bits (454), Expect = 6e-43 Identities = 82/93 (88%), Positives = 88/93 (94%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFN +KLRISLGDI+LM+ GQPLPFDRVAASNYL+K G++HGTV Sbjct: 338 DPNWGRIACAAGYAGIPFNSDKLRISLGDIVLMEAGQPLPFDRVAASNYLRKAGDVHGTV 397 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 IQIS GDGPGSGLAWGCDLSYDYVKINAEYTT Sbjct: 398 EIQISTGDGPGSGLAWGCDLSYDYVKINAEYTT 430 >ref|XP_009626976.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03124} isoform X1 [Nicotiana tomentosiformis] Length = 471 Score = 179 bits (454), Expect = 6e-43 Identities = 82/93 (88%), Positives = 88/93 (94%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFN +KLRISLGDI+LM+ GQPLPFDRVAASNYL+K G++HGTV Sbjct: 379 DPNWGRIACAAGYAGIPFNSDKLRISLGDIVLMEAGQPLPFDRVAASNYLRKAGDVHGTV 438 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 IQIS GDGPGSGLAWGCDLSYDYVKINAEYTT Sbjct: 439 EIQISTGDGPGSGLAWGCDLSYDYVKINAEYTT 471 >ref|XP_004246463.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X2 [Solanum lycopersicum] Length = 470 Score = 179 bits (454), Expect = 6e-43 Identities = 83/93 (89%), Positives = 88/93 (94%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFN +KLRISLGDI+LM+ GQPLPFDRVAASNYL+K GE+HGTV Sbjct: 378 DPNWGRIACAAGYAGIPFNADKLRISLGDIVLMEAGQPLPFDRVAASNYLRKAGEVHGTV 437 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 IQISIGDG GSGLAWGCDLSYDYVKINAEYTT Sbjct: 438 EIQISIGDGSGSGLAWGCDLSYDYVKINAEYTT 470 >ref|XP_009769042.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X2 [Nicotiana sylvestris] Length = 430 Score = 177 bits (450), Expect = 2e-42 Identities = 81/93 (87%), Positives = 88/93 (94%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFN +KL+ISLGDI+LM+ GQPLPFDRVAASNYL+K G++HGTV Sbjct: 338 DPNWGRIACAAGYAGIPFNSDKLQISLGDIVLMEAGQPLPFDRVAASNYLRKAGDVHGTV 397 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 IQIS GDGPGSGLAWGCDLSYDYVKINAEYTT Sbjct: 398 EIQISTGDGPGSGLAWGCDLSYDYVKINAEYTT 430 >ref|XP_009769041.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X1 [Nicotiana sylvestris] Length = 471 Score = 177 bits (450), Expect = 2e-42 Identities = 81/93 (87%), Positives = 88/93 (94%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPFN +KL+ISLGDI+LM+ GQPLPFDRVAASNYL+K G++HGTV Sbjct: 379 DPNWGRIACAAGYAGIPFNSDKLQISLGDIVLMEAGQPLPFDRVAASNYLRKAGDVHGTV 438 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 IQIS GDGPGSGLAWGCDLSYDYVKINAEYTT Sbjct: 439 EIQISTGDGPGSGLAWGCDLSYDYVKINAEYTT 471 >ref|XP_002274213.2| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Vitis vinifera] gi|297741477|emb|CBI32609.3| unnamed protein product [Vitis vinifera] Length = 470 Score = 173 bits (439), Expect = 3e-41 Identities = 81/93 (87%), Positives = 83/93 (89%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPF PNKL ISLG+ILLM+GGQPLPFDR AASNYLKK GE HGTV Sbjct: 378 DPNWGRIACAAGYAGIPFQPNKLHISLGEILLMEGGQPLPFDRAAASNYLKKAGETHGTV 437 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 I ISIGDG G G AWGCDLSYDYVKINAEYTT Sbjct: 438 GIHISIGDGAGRGQAWGCDLSYDYVKINAEYTT 470 >sp|A5AEC8.1|ARGJ_VITVI RecName: Full=Arginine biosynthesis bifunctional protein ArgJ, chloroplastic; Includes: RecName: Full=Glutamate N-acetyltransferase; Short=GAT; AltName: Full=Ornithine acetyltransferase; Short=OATase; AltName: Full=Ornithine transacetylase; Includes: RecName: Full=Amino-acid acetyltransferase; AltName: Full=N-acetylglutamate synthase; Short=AGS; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ alpha chain; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ beta chain; Flags: Precursor [Vitis vinifera] gi|147801761|emb|CAN77854.1| hypothetical protein VITISV_037692 [Vitis vinifera] Length = 510 Score = 173 bits (439), Expect = 3e-41 Identities = 81/93 (87%), Positives = 83/93 (89%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYAGIPF PNKL ISLG+ILLM+GGQPLPFDR AASNYLKK GE HGTV Sbjct: 418 DPNWGRIACAAGYAGIPFQPNKLHISLGEILLMEGGQPLPFDRAAASNYLKKAGETHGTV 477 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 I ISIGDG G G AWGCDLSYDYVKINAEYTT Sbjct: 478 GIHISIGDGAGRGQAWGCDLSYDYVKINAEYTT 510 >gb|KMT02706.1| hypothetical protein BVRB_8g192960 isoform B [Beta vulgaris subsp. vulgaris] Length = 236 Score = 170 bits (430), Expect = 4e-40 Identities = 78/93 (83%), Positives = 84/93 (90%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYA IPFN NKLRI+LGDI+LMDGGQPLPFDR AAS+YL+K GE HGTV Sbjct: 144 DPNWGRIACAAGYATIPFNLNKLRIALGDIVLMDGGQPLPFDRAAASSYLRKAGEEHGTV 203 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 + IS+GDGPG G AWGCDLSYDYVKINAEYTT Sbjct: 204 EMHISVGDGPGEGKAWGCDLSYDYVKINAEYTT 236 >ref|XP_010687830.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X2 [Beta vulgaris subsp. vulgaris] Length = 433 Score = 170 bits (430), Expect = 4e-40 Identities = 78/93 (83%), Positives = 84/93 (90%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYA IPFN NKLRI+LGDI+LMDGGQPLPFDR AAS+YL+K GE HGTV Sbjct: 341 DPNWGRIACAAGYATIPFNLNKLRIALGDIVLMDGGQPLPFDRAAASSYLRKAGEEHGTV 400 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 + IS+GDGPG G AWGCDLSYDYVKINAEYTT Sbjct: 401 EMHISVGDGPGEGKAWGCDLSYDYVKINAEYTT 433 >ref|XP_010687828.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X1 [Beta vulgaris subsp. vulgaris] gi|731352981|ref|XP_010687829.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X1 [Beta vulgaris subsp. vulgaris] gi|870850639|gb|KMT02705.1| hypothetical protein BVRB_8g192960 isoform A [Beta vulgaris subsp. vulgaris] Length = 470 Score = 170 bits (430), Expect = 4e-40 Identities = 78/93 (83%), Positives = 84/93 (90%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGYA IPFN NKLRI+LGDI+LMDGGQPLPFDR AAS+YL+K GE HGTV Sbjct: 378 DPNWGRIACAAGYATIPFNLNKLRIALGDIVLMDGGQPLPFDRAAASSYLRKAGEEHGTV 437 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 + IS+GDGPG G AWGCDLSYDYVKINAEYTT Sbjct: 438 EMHISVGDGPGEGKAWGCDLSYDYVKINAEYTT 470 >ref|XP_010253268.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Nelumbo nucifera] Length = 469 Score = 169 bits (429), Expect = 5e-40 Identities = 79/93 (84%), Positives = 83/93 (89%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIACAAGY+GIPF PNKLRISLGDILLMDGGQPLPFDR AAS+YLK G+ HGTV Sbjct: 377 DPNWGRIACAAGYSGIPFQPNKLRISLGDILLMDGGQPLPFDRNAASDYLKNAGKTHGTV 436 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 I IS+G G GSG AWGCDLSYDYVKINAEYTT Sbjct: 437 GIHISVGTGQGSGKAWGCDLSYDYVKINAEYTT 469 >ref|XP_011003556.1| PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Populus euphratica] Length = 481 Score = 167 bits (423), Expect = 2e-39 Identities = 79/93 (84%), Positives = 82/93 (88%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIA AAGYAGIPF+ N LRI LGDILLMD GQPL FDR AASNYL+K GEIHGTV Sbjct: 389 DPNWGRIAAAAGYAGIPFHQNNLRIMLGDILLMDNGQPLSFDRSAASNYLRKAGEIHGTV 448 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 I IS+GDGPGSG AWGCDLSYDYVKINAEYTT Sbjct: 449 GIYISVGDGPGSGQAWGCDLSYDYVKINAEYTT 481 >ref|XP_006376966.1| arginine biosynthesis protein ArgJ [Populus trichocarpa] gi|586830441|sp|B9NAN0.2|ARGJ_POPTR RecName: Full=Arginine biosynthesis bifunctional protein ArgJ, chloroplastic; Includes: RecName: Full=Glutamate N-acetyltransferase; Short=GAT; AltName: Full=Ornithine acetyltransferase; Short=OATase; AltName: Full=Ornithine transacetylase; Includes: RecName: Full=Amino-acid acetyltransferase; AltName: Full=N-acetylglutamate synthase; Short=AGS; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ alpha chain; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ beta chain; Flags: Precursor gi|550326901|gb|ERP54763.1| arginine biosynthesis protein ArgJ [Populus trichocarpa] Length = 481 Score = 167 bits (423), Expect = 2e-39 Identities = 79/93 (84%), Positives = 82/93 (88%) Frame = -3 Query: 323 DPNWGRIACAAGYAGIPFNPNKLRISLGDILLMDGGQPLPFDRVAASNYLKKTGEIHGTV 144 DPNWGRIA AAGYAGIPF+ N LRI LGDILLMD GQPL FDR AASNYL+K GEIHGTV Sbjct: 389 DPNWGRIAAAAGYAGIPFHQNNLRIMLGDILLMDNGQPLSFDRSAASNYLRKAGEIHGTV 448 Query: 143 VIQISIGDGPGSGLAWGCDLSYDYVKINAEYTT 45 I IS+GDGPGSG AWGCDLSYDYVKINAEYTT Sbjct: 449 GIYISVGDGPGSGQAWGCDLSYDYVKINAEYTT 481