BLASTX nr result
ID: Forsythia23_contig00039946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00039946 (600 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089828.1| PREDICTED: uncharacterized protein LOC105170... 60 8e-07 >ref|XP_011089828.1| PREDICTED: uncharacterized protein LOC105170663 [Sesamum indicum] gi|747044584|ref|XP_011089837.1| PREDICTED: uncharacterized protein LOC105170663 [Sesamum indicum] gi|747044586|ref|XP_011089845.1| PREDICTED: uncharacterized protein LOC105170663 [Sesamum indicum] Length = 381 Score = 60.1 bits (144), Expect = 8e-07 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -2 Query: 440 MASKVPAQSQPRHNFDLPPLKWSKENQSS--RRRSVSIKSPSQKLSSGSPT 294 MAS VPA+SQP HNFDLP LKW+K+ SS +R SIKSPS++ ++ SP+ Sbjct: 1 MASTVPAKSQPLHNFDLPHLKWNKDGNSSGPHQRRRSIKSPSRRPNTSSPS 51