BLASTX nr result
ID: Forsythia23_contig00039209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00039209 (371 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002878174.1| basic helix-loop-helix family protein [Arabi... 65 2e-08 ref|XP_011071748.1| PREDICTED: transcription factor bHLH79-like ... 59 2e-06 >ref|XP_002878174.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] gi|297324012|gb|EFH54433.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] Length = 439 Score = 64.7 bits (156), Expect = 2e-08 Identities = 46/123 (37%), Positives = 66/123 (53%) Frame = -3 Query: 369 ARREKISERMKILQDLVPGCNKVSNFPPSFLISFVMVLDVTGSFDIHIDRQLNSM*NCLR 190 ARREKI+ RMK+LQ+LVPGC+K ++F I F +H+ + S + Sbjct: 221 ARREKINARMKLLQELVPGCDKGTDFGGKIKIKV--------CFGVHL--LMISGKKAVN 270 Query: 189 FIANMRIKSLLAIMVSRFDFIVV*CSLATTRQ*IKILLLQVIGKALVLDEIINYIQSLQR 10 F+ + + L+ + F + SLA + + G ALVLDEIIN++QSLQR Sbjct: 271 FLWKVSCEDLIDCSFNPLGFRLTRHSLAAS--------FTIQGTALVLDEIINHVQSLQR 322 Query: 9 QVE 1 QVE Sbjct: 323 QVE 325 >ref|XP_011071748.1| PREDICTED: transcription factor bHLH79-like isoform X1 [Sesamum indicum] Length = 286 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 369 ARREKISERMKILQDLVPGCNKVSNFPPSFLIS 271 ARREKISERMKILQDLVPGCNKV +F PSFL S Sbjct: 160 ARREKISERMKILQDLVPGCNKVFSFLPSFLDS 192