BLASTX nr result
ID: Forsythia23_contig00039160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00039160 (389 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00466.1| unnamed protein product [Coffea canephora] 63 9e-08 >emb|CDP00466.1| unnamed protein product [Coffea canephora] Length = 119 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 283 RVKMMKAPGRNYRMPRNVFESDPKGYFHNLRSYPGDELC 167 RVKMMKAPGRN M R FE++PK YF NLR++PGD+LC Sbjct: 81 RVKMMKAPGRNCTMARPAFEANPKSYFRNLRAHPGDQLC 119