BLASTX nr result
ID: Forsythia23_contig00039049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00039049 (414 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517977.1| acetylglucosaminyltransferase, putative [Ric... 64 5e-08 ref|XP_012088347.1| PREDICTED: xylosyltransferase 1-like [Jatrop... 61 3e-07 ref|XP_011100343.1| PREDICTED: xylosyltransferase 1-like [Sesamu... 60 4e-07 ref|XP_012852488.1| PREDICTED: xylosyltransferase 1 [Erythranthe... 59 2e-06 ref|XP_011039767.1| PREDICTED: xylosyltransferase 1-like [Populu... 58 3e-06 ref|XP_006357515.1| PREDICTED: xylosyltransferase 1-like [Solanu... 56 8e-06 ref|XP_002319376.2| glycosyltransferase family 14 family protein... 56 8e-06 ref|XP_004243326.1| PREDICTED: xylosyltransferase 1 [Solanum lyc... 56 8e-06 >ref|XP_002517977.1| acetylglucosaminyltransferase, putative [Ricinus communis] gi|223542959|gb|EEF44495.1| acetylglucosaminyltransferase, putative [Ricinus communis] Length = 439 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 108 LSMRKNANFYSGRIFSDRRWKIPFFVSFLVSITLF 4 LSMRKNANFYSGR+FSDR+W PFF S LVS+TLF Sbjct: 5 LSMRKNANFYSGRVFSDRKWFFPFFASLLVSLTLF 39 >ref|XP_012088347.1| PREDICTED: xylosyltransferase 1-like [Jatropha curcas] gi|643709773|gb|KDP24182.1| hypothetical protein JCGZ_25839 [Jatropha curcas] Length = 440 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 111 LLSMRKNANFYSGRIFSDRRWKIPFFVSFLVSITLF 4 L+SMRKNAN +SGR+FSDR+W IPFF S LVS+TLF Sbjct: 5 LMSMRKNANSHSGRVFSDRKWLIPFFASLLVSLTLF 40 >ref|XP_011100343.1| PREDICTED: xylosyltransferase 1-like [Sesamum indicum] Length = 436 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 102 MRKNANFYSGRIFSDRRWKIPFFVSFLVSITLFS 1 MRKN N + GR+FSDRRWKIPFFVS LVSITLF+ Sbjct: 1 MRKNVNSHPGRVFSDRRWKIPFFVSLLVSITLFT 34 >ref|XP_012852488.1| PREDICTED: xylosyltransferase 1 [Erythranthe guttatus] gi|604305824|gb|EYU24912.1| hypothetical protein MIMGU_mgv1a022320mg [Erythranthe guttata] Length = 434 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 102 MRKNANFYSGRIFSDRRWKIPFFVSFLVSITLFS 1 MRKN N +S R+FSDRRWK PFF+SFLVSITLF+ Sbjct: 1 MRKNVNSHSVRLFSDRRWKTPFFISFLVSITLFT 34 >ref|XP_011039767.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica] gi|743892824|ref|XP_011039768.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica] gi|743892828|ref|XP_011039769.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica] Length = 442 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 111 LLSMRKNANFYSGRIFSDRRWKIPFFVSFLVSITLFS 1 L+SMRKN N +SGR+F DRRW IPFF SFLV + LFS Sbjct: 7 LVSMRKNGNSHSGRLFGDRRWLIPFFTSFLVFLILFS 43 >ref|XP_006357515.1| PREDICTED: xylosyltransferase 1-like [Solanum tuberosum] Length = 448 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -1 Query: 135 RYFDSW*ELLSMRKNANFYSGRIFSDRRWKIPFFVSFLVSITLFS 1 +Y +S+ + KN N YSGR++ DR WKIPFFVS LVSITLF+ Sbjct: 3 KYANSYSGRVFNDKNGNSYSGRVYGDRHWKIPFFVSLLVSITLFT 47 >ref|XP_002319376.2| glycosyltransferase family 14 family protein [Populus trichocarpa] gi|550325826|gb|EEE95299.2| glycosyltransferase family 14 family protein [Populus trichocarpa] Length = 442 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 111 LLSMRKNANFYSGRIFSDRRWKIPFFVSFLVSITLFS 1 L+SMRKN + +SGR+FSDR+W IPFF S LV +TLFS Sbjct: 7 LVSMRKNGSSHSGRLFSDRKWLIPFFASLLVFLTLFS 43 >ref|XP_004243326.1| PREDICTED: xylosyltransferase 1 [Solanum lycopersicum] Length = 448 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -1 Query: 135 RYFDSW*ELLSMRKNANFYSGRIFSDRRWKIPFFVSFLVSITLFS 1 +Y +S+ + KN N YSGR++ DR WKIPFFVS LVSITLF+ Sbjct: 3 KYANSYSGRVFNDKNGNSYSGRVYGDRHWKIPFFVSLLVSITLFT 47