BLASTX nr result
ID: Forsythia23_contig00039032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00039032 (530 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089406.1| PREDICTED: nudix hydrolase 9 isoform X2 [Ses... 58 2e-06 ref|XP_011089405.1| PREDICTED: nudix hydrolase 9 isoform X1 [Ses... 58 2e-06 emb|CDP08982.1| unnamed protein product [Coffea canephora] 57 4e-06 ref|XP_006488239.1| PREDICTED: nudix hydrolase 9-like [Citrus si... 57 4e-06 ref|XP_006424732.1| hypothetical protein CICLE_v10028948mg [Citr... 57 4e-06 >ref|XP_011089406.1| PREDICTED: nudix hydrolase 9 isoform X2 [Sesamum indicum] Length = 258 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/46 (60%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = -1 Query: 530 LKFRYGGHVLSGSSDSSQETHACLHLGLTDYR--LSPSLSPLSHMF 399 LKFRYGGH LSG +DS ++T CLHLGLTDYR + +L+PL F Sbjct: 74 LKFRYGGHTLSGRADSFRKTDVCLHLGLTDYRTFVGTNLNPLWERF 119 >ref|XP_011089405.1| PREDICTED: nudix hydrolase 9 isoform X1 [Sesamum indicum] Length = 305 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/46 (60%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = -1 Query: 530 LKFRYGGHVLSGSSDSSQETHACLHLGLTDYR--LSPSLSPLSHMF 399 LKFRYGGH LSG +DS ++T CLHLGLTDYR + +L+PL F Sbjct: 74 LKFRYGGHTLSGRADSFRKTDVCLHLGLTDYRTFVGTNLNPLWERF 119 >emb|CDP08982.1| unnamed protein product [Coffea canephora] Length = 297 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/46 (58%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = -1 Query: 530 LKFRYGGHVLSGSSDSSQETHACLHLGLTDYR--LSPSLSPLSHMF 399 LKFRYGGH SG + + QE H CLHLGLTDYR + +L+PL F Sbjct: 66 LKFRYGGHSFSGGAGTDQEPHVCLHLGLTDYRTFVGTNLNPLWERF 111 >ref|XP_006488239.1| PREDICTED: nudix hydrolase 9-like [Citrus sinensis] Length = 298 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/45 (57%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = -1 Query: 527 KFRYGGHVLSGSSDSSQETHACLHLGLTDYR--LSPSLSPLSHMF 399 KFRYGGH++ G SS E+H CLHLGLTDYR + +L+PL F Sbjct: 65 KFRYGGHIMQGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKF 109 >ref|XP_006424732.1| hypothetical protein CICLE_v10028948mg [Citrus clementina] gi|557526666|gb|ESR37972.1| hypothetical protein CICLE_v10028948mg [Citrus clementina] Length = 295 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/45 (57%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = -1 Query: 527 KFRYGGHVLSGSSDSSQETHACLHLGLTDYR--LSPSLSPLSHMF 399 KFRYGGH++ G SS E+H CLHLGLTDYR + +L+PL F Sbjct: 65 KFRYGGHIMQGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKF 109