BLASTX nr result
ID: Forsythia23_contig00038988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00038988 (319 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIG89988.1| hypothetical protein (mitochondrion) [Capsicum an... 82 1e-17 >gb|AIG89988.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 115 Score = 81.6 bits (200), Expect(2) = 1e-17 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = -2 Query: 207 EKNEKSKGRLIQNPNYDIPSLPLHTSERTVLIEINALSHLLNPK*NGWGEERF 49 + EKSKGR IQNPN DIPSLPLHTSERT+LIEINALSHLLNPK G G+ F Sbjct: 8 KSKEKSKGRFIQNPNCDIPSLPLHTSERTLLIEINALSHLLNPKWLGRGKVPF 60 Score = 34.7 bits (78), Expect(2) = 1e-17 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 44 FFEGTPGNRSSGDG 3 FFEGTPGNRSSGDG Sbjct: 60 FFEGTPGNRSSGDG 73