BLASTX nr result
ID: Forsythia23_contig00038650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00038650 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010648531.1| PREDICTED: uncharacterized protein LOC104879... 59 1e-06 ref|XP_006483445.1| PREDICTED: uncharacterized protein LOC102619... 57 5e-06 >ref|XP_010648531.1| PREDICTED: uncharacterized protein LOC104879002 [Vitis vinifera] Length = 216 Score = 58.9 bits (141), Expect = 1e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -1 Query: 333 KKSVDKDQEWCDFCQKSRHTRSTCWKLNGKP 241 KK+ +KD +WCD+C + RHTR TCWKLNGKP Sbjct: 59 KKTGEKDTQWCDYCNRVRHTRKTCWKLNGKP 89 >ref|XP_006483445.1| PREDICTED: uncharacterized protein LOC102619128 [Citrus sinensis] Length = 368 Score = 57.0 bits (136), Expect = 5e-06 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -1 Query: 333 KKSVDKDQEWCDFCQKSRHTRSTCWKLNGKP 241 KKS +KD+ WCD+C K RHTR CWKL+GKP Sbjct: 261 KKSDEKDRVWCDYCHKPRHTRDACWKLHGKP 291