BLASTX nr result
ID: Forsythia23_contig00038540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00038540 (415 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010449879.1| PREDICTED: late embryogenesis abundant prote... 57 4e-06 >ref|XP_010449879.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina sativa] Length = 104 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 3/71 (4%) Frame = -1 Query: 328 RRSYAATSQ---AGHIGRRMGPQMVGDKKEERALNTDGPRPISDPWWGPDPITGYYRPVD 158 RRSY ATSQ A + + +++ K E+RAL+ + ++ WGPDP+TGYYRP D Sbjct: 28 RRSYVATSQNVTATGLSKGGSTRVMVGKIEQRALDQE-----AESAWGPDPVTGYYRPSD 82 Query: 157 WEAEIDPAFYR 125 AEIDPA R Sbjct: 83 RAAEIDPAELR 93