BLASTX nr result
ID: Forsythia23_contig00038499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00038499 (607 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009044647.1| hypothetical protein LOTGIDRAFT_202939 [Lott... 60 8e-07 ref|XP_007405671.1| hypothetical protein MELLADRAFT_92514 [Melam... 57 5e-06 ref|XP_007413090.1| hypothetical protein MELLADRAFT_90070 [Melam... 57 5e-06 ref|XP_007417422.1| hypothetical protein MELLADRAFT_94716 [Melam... 57 5e-06 ref|XP_007411822.1| hypothetical protein MELLADRAFT_88315 [Melam... 57 5e-06 ref|XP_007413092.1| hypothetical protein MELLADRAFT_90079 [Melam... 57 5e-06 ref|XP_001895031.1| hypothetical protein Bm1_17870 [Brugia malayi] 57 5e-06 >ref|XP_009044647.1| hypothetical protein LOTGIDRAFT_202939 [Lottia gigantea] gi|556116014|gb|ESP04666.1| hypothetical protein LOTGIDRAFT_202939 [Lottia gigantea] Length = 60 Score = 60.1 bits (144), Expect = 8e-07 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = -1 Query: 286 IECLLYQLWMVG*LPTMVMTGNGELGLDSGEQA*ETASRTKVCSRRETY 140 ++CL +QL MVG LPT V+TGNGE G DSGE A ETA+ +K SRR TY Sbjct: 1 MKCLSHQLAMVGDLPTTVLTGNGESGFDSGEGACETATTSKEGSRRATY 49 >ref|XP_007405671.1| hypothetical protein MELLADRAFT_92514 [Melampsora larici-populina 98AG31] gi|328861967|gb|EGG11069.1| hypothetical protein MELLADRAFT_92514 [Melampsora larici-populina 98AG31] Length = 126 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +2 Query: 149 APAADLSPTSRFSGLFSGVEP*LPVTRHHHGRQLPYHPQLIEQTLD 286 APAA L RFSG SG+EP PVTRHHHGR L YH +LI Q + Sbjct: 81 APAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 126 >ref|XP_007413090.1| hypothetical protein MELLADRAFT_90070 [Melampsora larici-populina 98AG31] gi|328854511|gb|EGG03643.1| hypothetical protein MELLADRAFT_90070 [Melampsora larici-populina 98AG31] Length = 379 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +2 Query: 149 APAADLSPTSRFSGLFSGVEP*LPVTRHHHGRQLPYHPQLIEQTLD 286 APAA L RFSG SG+EP PVTRHHHGR L YH +LI Q + Sbjct: 334 APAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 379 >ref|XP_007417422.1| hypothetical protein MELLADRAFT_94716 [Melampsora larici-populina 98AG31] gi|328850159|gb|EGF99328.1| hypothetical protein MELLADRAFT_94716 [Melampsora larici-populina 98AG31] Length = 361 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +2 Query: 149 APAADLSPTSRFSGLFSGVEP*LPVTRHHHGRQLPYHPQLIEQTLD 286 APAA L RFSG SG+EP PVTRHHHGR L YH +LI Q + Sbjct: 316 APAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 361 >ref|XP_007411822.1| hypothetical protein MELLADRAFT_88315 [Melampsora larici-populina 98AG31] gi|599424960|ref|XP_007417440.1| hypothetical protein MELLADRAFT_94739 [Melampsora larici-populina 98AG31] gi|328850145|gb|EGF99314.1| hypothetical protein MELLADRAFT_94739 [Melampsora larici-populina 98AG31] gi|328855945|gb|EGG05069.1| hypothetical protein MELLADRAFT_88315 [Melampsora larici-populina 98AG31] Length = 113 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +2 Query: 149 APAADLSPTSRFSGLFSGVEP*LPVTRHHHGRQLPYHPQLIEQTLD 286 APAA L RFSG SG+EP PVTRHHHGR L YH +LI Q + Sbjct: 68 APAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 113 >ref|XP_007413092.1| hypothetical protein MELLADRAFT_90079 [Melampsora larici-populina 98AG31] gi|599427384|ref|XP_007418191.1| hypothetical protein MELLADRAFT_95625 [Melampsora larici-populina 98AG31] gi|328849357|gb|EGF98539.1| hypothetical protein MELLADRAFT_95625 [Melampsora larici-populina 98AG31] gi|328854513|gb|EGG03645.1| hypothetical protein MELLADRAFT_90079 [Melampsora larici-populina 98AG31] Length = 88 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +2 Query: 149 APAADLSPTSRFSGLFSGVEP*LPVTRHHHGRQLPYHPQLIEQTLD 286 APAA L RFSG SG+EP PVTRHHHGR L YH +LI Q + Sbjct: 43 APAAILRFEGRFSGPLSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 88 >ref|XP_001895031.1| hypothetical protein Bm1_17870 [Brugia malayi] Length = 62 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +2 Query: 149 APAADLSPTSRFSGLFSGVEP*LPVTRHHHGRQLPYHPQLIEQTLD 286 APAA L SRFSG SGVEP VTR++HGR + YH +LI QTLD Sbjct: 5 APAAFLGCGSRFSGSLSGVEPLFSVTRYNHGRHINYHRKLIRQTLD 50