BLASTX nr result
ID: Forsythia23_contig00038422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00038422 (611 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010060339.1| PREDICTED: ATP synthase gamma chain, chlorop... 111 3e-22 ref|XP_012460725.1| PREDICTED: ATP synthase gamma chain, chlorop... 110 7e-22 ref|XP_009797125.1| PREDICTED: ATP synthase gamma chain, chlorop... 109 9e-22 emb|CDP05738.1| unnamed protein product [Coffea canephora] 109 1e-21 ref|XP_009628630.1| PREDICTED: ATP synthase gamma chain, chlorop... 108 2e-21 ref|XP_007020808.1| ATPase, F1 complex, gamma subunit protein [T... 108 2e-21 ref|XP_010276111.1| PREDICTED: ATP synthase gamma chain, chlorop... 108 2e-21 ref|XP_011097875.1| PREDICTED: ATP synthase gamma chain, chlorop... 108 3e-21 ref|XP_012070838.1| PREDICTED: ATP synthase gamma chain, chlorop... 107 6e-21 ref|XP_010532128.1| PREDICTED: ATP synthase gamma chain 2, chlor... 107 6e-21 ref|XP_010532125.1| PREDICTED: ATP synthase gamma chain 2, chlor... 107 6e-21 gb|KDP39139.1| hypothetical protein JCGZ_00896 [Jatropha curcas] 107 6e-21 ref|XP_002525795.1| ATP synthase gamma chain 2, chloroplast, put... 105 1e-20 ref|XP_006365954.1| PREDICTED: ATP synthase gamma chain, chlorop... 105 1e-20 ref|XP_004251463.1| PREDICTED: ATP synthase gamma chain, chlorop... 105 1e-20 ref|XP_003546151.2| PREDICTED: ATP synthase gamma chain, chlorop... 105 2e-20 ref|XP_004500078.1| PREDICTED: ATP synthase gamma chain, chlorop... 105 2e-20 ref|XP_003542865.1| PREDICTED: ATP synthase gamma chain, chlorop... 105 2e-20 ref|NP_173022.1| ATP synthase gamma chain 2 [Arabidopsis thalian... 105 2e-20 ref|XP_010476658.1| PREDICTED: ATP synthase gamma chain 2, chlor... 105 2e-20 >ref|XP_010060339.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like isoform X1 [Eucalyptus grandis] gi|702363488|ref|XP_010060341.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like isoform X2 [Eucalyptus grandis] gi|702363493|ref|XP_010060342.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like isoform X3 [Eucalyptus grandis] gi|629101522|gb|KCW66991.1| hypothetical protein EUGRSUZ_F00755 [Eucalyptus grandis] Length = 384 Score = 111 bits (277), Expect = 3e-22 Identities = 59/64 (92%), Positives = 61/64 (95%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGE+LEI+AGAEA Sbjct: 320 QILRALQESIASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGELLEIVAGAEA 379 Query: 429 LM*F 418 L F Sbjct: 380 LKDF 383 >ref|XP_012460725.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Gossypium raimondii] gi|763746260|gb|KJB13699.1| hypothetical protein B456_002G089300 [Gossypium raimondii] Length = 377 Score = 110 bits (274), Expect = 7e-22 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELAARMNAMSNATDNAVELKKNLSI YNRERQAKITGEILEI+AGAEA Sbjct: 316 QILRALQESLASELAARMNAMSNATDNAVELKKNLSIVYNRERQAKITGEILEIVAGAEA 375 Query: 429 L 427 L Sbjct: 376 L 376 >ref|XP_009797125.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Nicotiana sylvestris] Length = 377 Score = 109 bits (273), Expect = 9e-22 Identities = 56/61 (91%), Positives = 61/61 (100%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES+ASELAARMNAMSNATDNAV+LK+NLSIAYNRERQAKITGEILEI+AGA+A Sbjct: 316 QILRALQESFASELAARMNAMSNATDNAVDLKRNLSIAYNRERQAKITGEILEIVAGADA 375 Query: 429 L 427 L Sbjct: 376 L 376 >emb|CDP05738.1| unnamed protein product [Coffea canephora] Length = 301 Score = 109 bits (272), Expect = 1e-21 Identities = 56/62 (90%), Positives = 61/62 (98%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES+ASELAARMNAMSNAT+NA+ELKKNLSI YNRERQAKITGEILEI+AGAEA Sbjct: 240 QILRALQESFASELAARMNAMSNATENALELKKNLSITYNRERQAKITGEILEIVAGAEA 299 Query: 429 LM 424 L+ Sbjct: 300 LI 301 >ref|XP_009628630.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Nicotiana tomentosiformis] gi|697148881|ref|XP_009628631.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Nicotiana tomentosiformis] Length = 377 Score = 108 bits (271), Expect = 2e-21 Identities = 56/61 (91%), Positives = 61/61 (100%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES+ASELAARMNAMSNATDNAVELK+NLSIAY+RERQAKITGEILEI+AGA+A Sbjct: 316 QILRALQESFASELAARMNAMSNATDNAVELKRNLSIAYSRERQAKITGEILEIVAGADA 375 Query: 429 L 427 L Sbjct: 376 L 376 >ref|XP_007020808.1| ATPase, F1 complex, gamma subunit protein [Theobroma cacao] gi|508720436|gb|EOY12333.1| ATPase, F1 complex, gamma subunit protein [Theobroma cacao] Length = 377 Score = 108 bits (271), Expect = 2e-21 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELAARMNAMSNATDNAVEL+KNLSI YNRERQAKITGEILEI+AGAEA Sbjct: 316 QILRALQESLASELAARMNAMSNATDNAVELRKNLSIVYNRERQAKITGEILEIVAGAEA 375 Query: 429 L 427 L Sbjct: 376 L 376 >ref|XP_010276111.1| PREDICTED: ATP synthase gamma chain, chloroplastic [Nelumbo nucifera] Length = 376 Score = 108 bits (270), Expect = 2e-21 Identities = 57/61 (93%), Positives = 60/61 (98%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELAARM+AMSNATDNAVELK+NLSIAYNRERQAKITGEILEI+AGAEA Sbjct: 315 QILRALQESLASELAARMSAMSNATDNAVELKRNLSIAYNRERQAKITGEILEIVAGAEA 374 Query: 429 L 427 L Sbjct: 375 L 375 >ref|XP_011097875.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Sesamum indicum] Length = 379 Score = 108 bits (269), Expect = 3e-21 Identities = 56/61 (91%), Positives = 60/61 (98%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQESYASELAARMNAMSNAT+NAVEL ++LSIAYNRERQAKITGEILEI+AGAEA Sbjct: 317 QILRALQESYASELAARMNAMSNATENAVELSRSLSIAYNRERQAKITGEILEIVAGAEA 376 Query: 429 L 427 L Sbjct: 377 L 377 >ref|XP_012070838.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Jatropha curcas] Length = 380 Score = 107 bits (266), Expect = 6e-21 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELAARMNAMSNATDNAV+LKKNLS+ YNRERQ+KITGEILEI+AGAEA Sbjct: 316 QILRALQESLASELAARMNAMSNATDNAVDLKKNLSVEYNRERQSKITGEILEIVAGAEA 375 Query: 429 L 427 L Sbjct: 376 L 376 >ref|XP_010532128.1| PREDICTED: ATP synthase gamma chain 2, chloroplastic isoform X2 [Tarenaya hassleriana] Length = 349 Score = 107 bits (266), Expect = 6e-21 Identities = 54/61 (88%), Positives = 61/61 (100%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES+ASELA+RM+AMSNATDNAVELKKNL++AYNRERQAKITGE+LEI+AGAEA Sbjct: 285 QILRALQESFASELASRMSAMSNATDNAVELKKNLTMAYNRERQAKITGELLEIVAGAEA 344 Query: 429 L 427 L Sbjct: 345 L 345 >ref|XP_010532125.1| PREDICTED: ATP synthase gamma chain 2, chloroplastic isoform X1 [Tarenaya hassleriana] gi|729317035|ref|XP_010532127.1| PREDICTED: ATP synthase gamma chain 2, chloroplastic isoform X1 [Tarenaya hassleriana] Length = 382 Score = 107 bits (266), Expect = 6e-21 Identities = 54/61 (88%), Positives = 61/61 (100%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES+ASELA+RM+AMSNATDNAVELKKNL++AYNRERQAKITGE+LEI+AGAEA Sbjct: 318 QILRALQESFASELASRMSAMSNATDNAVELKKNLTMAYNRERQAKITGELLEIVAGAEA 377 Query: 429 L 427 L Sbjct: 378 L 378 >gb|KDP39139.1| hypothetical protein JCGZ_00896 [Jatropha curcas] Length = 373 Score = 107 bits (266), Expect = 6e-21 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELAARMNAMSNATDNAV+LKKNLS+ YNRERQ+KITGEILEI+AGAEA Sbjct: 309 QILRALQESLASELAARMNAMSNATDNAVDLKKNLSVEYNRERQSKITGEILEIVAGAEA 368 Query: 429 L 427 L Sbjct: 369 L 369 >ref|XP_002525795.1| ATP synthase gamma chain 2, chloroplast, putative [Ricinus communis] gi|223534945|gb|EEF36631.1| ATP synthase gamma chain 2, chloroplast, putative [Ricinus communis] Length = 381 Score = 105 bits (263), Expect = 1e-20 Identities = 55/61 (90%), Positives = 60/61 (98%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELAARMNAMSNATDNAV+L+K+LSIAYNRERQ+KITGEILEI+AGAEA Sbjct: 317 QILRALQESLASELAARMNAMSNATDNAVDLQKSLSIAYNRERQSKITGEILEIVAGAEA 376 Query: 429 L 427 L Sbjct: 377 L 377 >ref|XP_006365954.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Solanum tuberosum] Length = 362 Score = 105 bits (263), Expect = 1e-20 Identities = 54/61 (88%), Positives = 61/61 (100%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES+ASELAARMNAMS+ATDNAVEL+++LSIAYNRERQAKITGEILEI+AGA+A Sbjct: 301 QILRALQESFASELAARMNAMSSATDNAVELRRDLSIAYNRERQAKITGEILEIVAGADA 360 Query: 429 L 427 L Sbjct: 361 L 361 >ref|XP_004251463.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Solanum lycopersicum] Length = 349 Score = 105 bits (263), Expect = 1e-20 Identities = 53/62 (85%), Positives = 62/62 (100%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES+ASE+AARMNAM++ATDNAVEL++NLSIAYNRERQAKITGEILEI+AGA+A Sbjct: 287 QILRALQESFASEVAARMNAMTSATDNAVELRRNLSIAYNRERQAKITGEILEIVAGADA 346 Query: 429 LM 424 L+ Sbjct: 347 LI 348 >ref|XP_003546151.2| PREDICTED: ATP synthase gamma chain, chloroplastic [Glycine max] gi|734404516|gb|KHN33027.1| ATP synthase gamma chain, chloroplastic [Glycine soja] Length = 375 Score = 105 bits (262), Expect = 2e-20 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 Q+LRALQES ASELAARM+AMSNATDNA+ELKKNLSI YNRERQAKITGEILEI+AGA A Sbjct: 314 QVLRALQESLASELAARMSAMSNATDNAIELKKNLSIVYNRERQAKITGEILEIVAGANA 373 Query: 429 L 427 L Sbjct: 374 L 374 >ref|XP_004500078.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cicer arietinum] Length = 349 Score = 105 bits (262), Expect = 2e-20 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 Q+L+ALQES ASELAARM AMS+ATDNAVELKKNLS+AYNRERQAKITGEILEI+AGAEA Sbjct: 285 QVLKALQESLASELAARMGAMSSATDNAVELKKNLSVAYNRERQAKITGEILEIVAGAEA 344 Query: 429 L 427 L Sbjct: 345 L 345 >ref|XP_003542865.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like isoform 3 [Glycine max] gi|734415192|gb|KHN37604.1| ATP synthase gamma chain, chloroplastic [Glycine soja] Length = 375 Score = 105 bits (262), Expect = 2e-20 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 Q+LRALQES ASELAARM+AMSNATDNA+ELKKNLSI YNRERQAKITGEILEI+AGA A Sbjct: 314 QVLRALQESLASELAARMSAMSNATDNAIELKKNLSIVYNRERQAKITGEILEIVAGANA 373 Query: 429 L 427 L Sbjct: 374 L 374 >ref|NP_173022.1| ATP synthase gamma chain 2 [Arabidopsis thaliana] gi|461551|sp|Q01909.1|ATPG2_ARATH RecName: Full=ATP synthase gamma chain 2, chloroplastic; AltName: Full=F-ATPase gamma subunit 2; Flags: Precursor gi|8927649|gb|AAF82140.1|AC034256_4 Identical to ATP sythase gamma subunit (atpC2) from Arabidopsis thaliana gb|M61742 and contains an ATP synthase PF|00231 domain [Arabidopsis thaliana] gi|166788|gb|AAA32833.1| ATP synthase gamma-subunit [Arabidopsis thaliana] gi|17529042|gb|AAL38731.1| putative ATP synthase gamma-subunit [Arabidopsis thaliana] gi|21436197|gb|AAM51386.1| putative ATP synthase gamma-subunit [Arabidopsis thaliana] gi|332191230|gb|AEE29351.1| ATP synthase gamma chain 2 [Arabidopsis thaliana] Length = 386 Score = 105 bits (261), Expect = 2e-20 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELA+RMNAMSNATDNAVELKKNL++AYNR RQAKITGE+LEI+AGAEA Sbjct: 323 QILRALQESLASELASRMNAMSNATDNAVELKKNLTMAYNRARQAKITGELLEIVAGAEA 382 Query: 429 L 427 L Sbjct: 383 L 383 >ref|XP_010476658.1| PREDICTED: ATP synthase gamma chain 2, chloroplastic-like [Camelina sativa] Length = 386 Score = 105 bits (261), Expect = 2e-20 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 609 QILRALQESYASELAARMNAMSNATDNAVELKKNLSIAYNRERQAKITGEILEIIAGAEA 430 QILRALQES ASELA+RMNAMSNATDNAVELKKNL++AYNR RQAKITGE+LEI+AGAEA Sbjct: 323 QILRALQESLASELASRMNAMSNATDNAVELKKNLTMAYNRARQAKITGELLEIVAGAEA 382 Query: 429 L 427 L Sbjct: 383 L 383