BLASTX nr result
ID: Forsythia23_contig00038391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00038391 (482 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009800134.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 ref|XP_009595574.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 >ref|XP_009800134.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nicotiana sylvestris] Length = 587 Score = 56.2 bits (134), Expect = 8e-06 Identities = 41/107 (38%), Positives = 56/107 (52%), Gaps = 4/107 (3%) Frame = +3 Query: 174 MELMMSARQTHESFWSFHHPXXXXXXXXXXXXFCCSN--FVSEKRKIDLS--RKRRRNRV 341 MEL++ +QTHE F SFH + C+N F S K+ + RK+R+++V Sbjct: 1 MELIVPTKQTHEGFCSFH---STRKEITSKRLWGCNNRRFRSSSIKVLVGQLRKQRQSKV 57 Query: 342 LAVSKTETYCTNGRLKLSNMEKNPQGQGXXXXXXXXXXXXXYLRRLV 482 A+S++ET TNGR LS +EK P QG YLRRLV Sbjct: 58 FAISRSETLGTNGR--LSCVEKRPHVQGSISENFEEFESNNYLRRLV 102 >ref|XP_009595574.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nicotiana tomentosiformis] Length = 587 Score = 56.2 bits (134), Expect = 8e-06 Identities = 41/107 (38%), Positives = 55/107 (51%), Gaps = 4/107 (3%) Frame = +3 Query: 174 MELMMSARQTHESFWSFHHPXXXXXXXXXXXXFCCSN--FVSEKRKIDLS--RKRRRNRV 341 MEL++ +QTHE F SFH C+N F S K+ + RK+R+++V Sbjct: 1 MELIVPTKQTHEGFCSFHSTRKEITSKRLSG---CNNRRFRSSSIKVLVGQLRKQRQSKV 57 Query: 342 LAVSKTETYCTNGRLKLSNMEKNPQGQGXXXXXXXXXXXXXYLRRLV 482 A+S++ET TNGR LS +EK P QG YLRRLV Sbjct: 58 FAISRSETLGTNGR--LSCVEKRPHVQGSISENFEEFESNNYLRRLV 102